KEGG   Ictalurus punctatus (channel catfish): 108255852Help
Entry
108255852         CDS       T04658                                 

Definition
(RefSeq) hexokinase-2-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00010  Glycolysis / Gluconeogenesis
ipu00051  Fructose and mannose metabolism
ipu00052  Galactose metabolism
ipu00500  Starch and sucrose metabolism
ipu00520  Amino sugar and nucleotide sugar metabolism
ipu00524  Neomycin, kanamycin and gentamicin biosynthesis
ipu01100  Metabolic pathways
ipu01200  Carbon metabolism
ipu04910  Insulin signaling pathway
Module
ipu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ipu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ipu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108255852
   00051 Fructose and mannose metabolism
    108255852
   00052 Galactose metabolism
    108255852
   00500 Starch and sucrose metabolism
    108255852
   00520 Amino sugar and nucleotide sugar metabolism
    108255852
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108255852
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    108255852
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108255852
Membrane trafficking [BR:ipu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    108255852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_1 Hexokinase_2 Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 108255852
NCBI-ProteinID: XP_017307640
UniProt: A0A2D0PRD4
LinkDB All DBs
Position
22
AA seq 913 aa AA seqDB search
MAFDLIKFTLCPSLEDFDRCRKDELLLIGDFFDVALPRTASEKVVKAALYEALVDQQILP
ERGALPGVAAQPVQLTQPTQPLPVTGRAEAVTEPEDKVVAGCEQPEAGTVDPGWQLALKE
LELEIKRQEYQTQLLRVREPERDAEGRRLDLAARQRKPVPLPRKLNSLRATSPCSGDAEH
TSPQPTPGPSSSVDKFLYHLRLSNENLMDVSLRFRREMDRGLGRDTNLTASVKMLPTFVR
STPDGTEKGDFLALDLGGTNFRVLRVKVSSNGKQTVEMENQIYAIPETLMRGSGTELFDH
IAECLANFLEKLGIKEQKLPLGFTFSFPCQQTKLDESFLVSWTKGFKANGVEGKDVVDLL
RKAIRRRGDFDIDIVAVINDTVGTMMTCGFDDHHCEIGLIVGTGTNACYMEEMRNLELVE
GDEGRMCVNMEWGAFGDDGALDDIRTDFDREIDAGSLNPGKQLFEKMISGMYMGELVRII
LVKMTKEGLLFQGRTTPELLVTGHFKTSYVSAIENDKSKEGLVCVEQVLRDLGLDPSPED
CVAVQRVCHIVSTRAAHLCAATLAAVLRQIRDNKAVDRLRTTIGVDGSVYKNHPQFARRL
HKMVRLLVPDCDVRFLRSEDGSGKGAAMVTAVAYRLAKQHAERQQVLDTLRLSREQLMEV
KRRMEVQMKRGLAQDTHNSATVKMLPTYVRATPDGTEHGDFLALDLGGTNFRVLLVRVRS
GKRRSVEMHNKIYTISQDVMQGTGEELFDHIVHCIADFLEYMGMKGASLPLGFTFSFPCH
QAGLNKGILLKWTKGFKASGCEGEDVAALLKDAIHRVEEFDLDVVAVVNDTVGTMMSCGY
ENPQCEVGLIVGTGTNACYMEEMRNVELVEGDEGRMCVNMEWGAFGDGGELDDIGTEFDR
AVDENSTNPGKQR
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgatttgattaagtttacgttgtgtccttcgttagaggactttgataggtgt
aggaaggatgagctgctccttattggagacttttttgatgtggcacttccccgtacggct
agcgaaaaggtggttaaagcagcgttgtatgaggcactcgtagatcaacagatcctaccg
gagcgtggagcacttccgggcgtcgccgcgcagcctgtgcagcttacgcagcctacccag
cctcttccggttaccggcagggcggaggccgtgactgagccggaggataaggttgttgcg
ggttgtgaacagcctgaggccggcacagtggaccccggttggcaactagcgctaaaagag
cttgagttggagattaagcggcaagagtaccagacgcagctcctgcgagttcgggagcct
gagcgggatgctgaagggagaaggctcgacctggcagctcggcagcggaagccggtgccg
ctgccacggaagctgaactccctgagagcaacctccccgtgttccggtgacgcagagcac
accagcccgcagccgactccagggccgtcctcatcggtggataagttcctgtaccacctc
cgtctgtccaacgagaacctgatggacgtgtccctgcgcttccggagggaaatggacaga
ggcctgggcagggacaccaacctcacagcctcggtcaaaatgctgcccacatttgtgcgc
tccacacctgatggcacagaaaaaggcgacttcctggcgctggacctcggcgggacgaac
ttccgagtcctgcgcgttaaagtgtcgtctaacggcaaacagacggtggagatggagaat
cagatttatgccattcctgagactctgatgaggggcagcgggacagagctgtttgaccac
atcgctgaatgtttggctaacttcctggagaaactgggtataaaggagcagaagctgccg
ctgggcttcaccttctccttcccctgccagcagaccaaacttgacgagagcttcctggtg
tcgtggaccaagggcttcaaggcgaacggggtggaggggaaagacgtggtggacctgctg
aggaaagccatcaggaggagaggggacttcgacatcgatattgtcgctgtgatcaacgac
accgtaggcaccatgatgacctgcggcttcgacgaccatcactgcgagatcggcctcatc
gtaggtacgggtacgaacgcgtgctacatggaggagatgaggaatctggagctggtggag
ggagacgagggccgcatgtgtgtgaacatggagtggggggcgttcggagacgacggcgct
ctcgacgacattcgcaccgacttcgaccgcgagatcgacgccggatcgctgaaccctggc
aaacagctatttgagaagatgatcagtgggatgtacatgggtgagctggtgcgcatcatc
ctggtgaagatgactaaagaaggactgctgttccagggccggaccacgcccgagctgctc
gtcaccggccacttcaaaaccagctacgtctcagccatcgagaatgacaagagtaaggaa
ggcctggtgtgcgtggaacaggttctgcgtgatctgggactggatccatctcctgaggac
tgtgtggcggtgcagcgcgtgtgtcatatcgtgtcgacgcgagcggctcacctgtgcgcc
gcgacgctcgccgccgtgctgcggcagatccgggacaacaaggccgtggatagattgcgc
accacgatcggagtggacggatccgtgtacaagaaccacccgcagtttgcgcggcggtta
cacaagatggtgcgcttgttggtgcctgactgtgacgtgcgtttcctgcgctcggaggac
ggcagcgggaagggcgcggccatggtaacggcggtggcctacaggttggcgaagcagcac
gccgagcgccagcaggtcctggacacgctgcggctcagccgggaacagctgatggaggtg
aagaggaggatggaggtgcagatgaagaggggactcgcccaggacacccacaactcggcc
accgtcaaaatgctgcccacctacgtcagagccacgcccgacggcacagagcacggagac
ttcctggcgctggatctgggcgggaccaacttccgagtgctgctggttcgagtgcgcagc
gggaagcggcgcagcgtggagatgcacaacaagatttacaccatttcacaggacgtcatg
cagggcacgggggaagagctgtttgatcacatcgtccactgcatcgctgacttcctggag
tacatgggaatgaagggagcgtcattacctctgggtttcaccttctcttttccctgccat
caagctggattgaacaagggcattctgctgaagtggacgaagggcttcaaggctagcggc
tgtgaaggcgaagacgtagcggcgctgctcaaagacgccattcatcgcgtggaggaattc
gatctggacgtggttgccgtggtgaacgacacggtggggacgatgatgtcgtgcggatac
gagaaccctcagtgtgaagtggggctcatcgtaggtacgggtacgaacgcgtgctacatg
gaggagatgaggaacgtggagctggtggagggagacgagggccgcatgtgtgtgaacatg
gagtggggggcgttcggagacggcggcgagctcgacgatatcggcaccgagttcgaccgc
gccgtggatgaaaactccaccaatcccggcaaacagaggtga

DBGET integrated database retrieval system