KEGG   Ictalurus punctatus (channel catfish): 108255959Help
Entry
108255959         CDS       T04658                                 

Gene name
galnt9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00512  Mucin type O-glycan biosynthesis
ipu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    108255959 (galnt9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ipu01003]
    108255959 (galnt9)
Enzymes [BR:ipu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     108255959 (galnt9)
Glycosyltransferases [BR:ipu01003]
 O-Glycan biosynthesis
  Mucin-type
   108255959 (galnt9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 108255959
NCBI-ProteinID: XP_017307854
UniProt: A0A2D0PPB4
LinkDB All DBs
Position
22
AA seq 603 aa AA seqDB search
MAAARKIKTLLTVNILVFVGIVLFSVYCRIQDRSEELVQLGRSGEARARTRHGKVTDTDR
QSILQRLERLEDVVYNQLNGVSKAMGLLEGPGGLGQGGAAATLGGESPEGGGKYEEYGYN
AQLSERISLDRNIPDYRPKKCKQLTYPDDLPQISVVFIFVNEALSVILRSVHSVVNHTPA
HLLKEIILVDDNSDSVELKYNLDQYVNKRYPGLVKIVRNSKREGLIRARIHGWNAATAPV
VGFFDAHVEFNTAWAEPILSRIKEARSRIILPAIDNIKYNTFEVQQYANAAHGYNWGLWC
MYIIPPQDWLDKGDETAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMRV
WQCGGSMEVLPCARVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDEFKSHVYMAWNIPM
NNPGVDFGDVSERVALRNRMKCKSFRWYLQHVYPEMRIYNNTITYGEVRNSKASGYCLDQ
GSEDDNRAILYPCHGMSSQLARYSTEGVLQLGPLGSTTFLPDTKCLIDDGRGRTPSLKKC
DAVSRSSQRLWDFTQNGPIINRDTGRCLEVEMSKEASFGLRLVLQRCSGQKWMIRNWIKH
PRH
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggcacggaaaatcaaaactttgctgacggtgaacatcctggtgttcgtcggc
atcgtgttgttctcggtgtactgccggatccaggaccggtccgaggagctcgtgcagctc
gggaggtcgggggaggcgcgcgcgcggacccgacatggcaaagttaccgacacggaccgg
cagtccatcctccagagactggagaggctcgaggacgtggtgtacaaccagctcaacgga
gtgtcgaaggcgatggggctgctggaggggcctggaggtctcggtcaaggaggagctgca
gccacacttgggggtgaaagtccagaaggcggaggcaaatacgaagagtacggctacaac
gcccagctcagcgagcgcatctccctggacaggaacattcccgactacaggcctaaaaag
tgtaaacagctgacgtaccctgacgacctgccgcagatctcggtggtgttcatctttgtg
aatgaagctctgtcggtgatcctgcgctccgtacacagcgtggtcaatcacacccctgct
cacctgctgaaggagatcatcctggtggacgacaacagcgacagcgtggagctgaagtat
aacctggatcagtacgtgaataaacgttatcccgggttagtgaagatcgtgaggaactct
aagagggagggtctgatccgcgctcggattcacggctggaacgctgctacggctcctgta
gtcggattctttgacgcacatgtggagtttaacacggcctgggccgagccgatcctgtcc
cggataaaagaagcccgcagtcggataatcctgcctgcgatagataacatcaagtacaac
accttcgaggtgcagcagtacgctaacgccgctcacggctacaactggggcctgtggtgc
atgtacatcattcctcctcaggactggctggataaaggagacgagaccgcccccatcagg
actcctgcgatgattggctgctcgttcgtggtggatcgtgagtattttggagaaatcggc
ctcctggatccaggcatggaggtttacggaggagagaatattgaactggggatgagggtg
tggcagtgtgggggcagtatggaggttttgccctgtgcccgagtcgctcacatcgaacgc
actaagaagccctacaacaacgacatcgactactacgccaagcggaacgccctgagggcc
gctgaggtctggatggatgagttcaagtcccatgtctacatggcctggaacatccccatg
aataatcccggcgtggatttcggagacgtgtcagagcgagtggccctgaggaacagaatg
aagtgtaagagcttccgctggtacctgcagcacgtttaccctgagatgaggatctacaac
aacaccatcacgtacggcgaggtgaggaacagtaaagcgagcggttattgcctggatcaa
ggctcagaggatgataacagagcgatactttacccctgtcacggcatgtcgtctcagtta
gcgcggtactctacagagggcgtgctgcagttaggacccctgggctctaccacgttttta
ccggacactaaatgtctgattgacgatgggcggggtcgaacgccgagcttaaagaaatgt
gacgcagtgtcgcgatcctcacagagactttgggacttcacacagaacggtccgattata
aacagagacacgggccgctgtctggaggtggagatgtctaaggaggcgagttttgggctg
cggttggttctgcagcgctgctcgggacagaagtggatgatccggaactggattaaacac
cccagacactga

DBGET integrated database retrieval system