KEGG   Ictalurus punctatus (channel catfish): 108256446Help
Entry
108256446         CDS       T04658                                 

Gene name
gys1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00500  Starch and sucrose metabolism
ipu01100  Metabolic pathways
ipu04910  Insulin signaling pathway
Module
ipu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    108256446 (gys1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108256446 (gys1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ipu01003]
    108256446 (gys1)
Enzymes [BR:ipu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     108256446 (gys1)
Glycosyltransferases [BR:ipu01003]
 Polysaccharide
  Storage polysaccharide
   108256446 (gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 108256446
NCBI-ProteinID: XP_017308831
UniProt: W5UFC0
LinkDB All DBs
Position
2
AA seq 700 aa AA seqDB search
MPLSRSISVTSLSGLEEWDEEFDLEDAVLFEIAWEVANKVGGIYTVIQTKARLTCEEWGE
NYFLVGPYMESNVRTQVELIEPPNPTLRRTIDKMNSSGCKVYFGRWLIEGSPYVILLDVG
FTAWSLDRWKSELWENCAIGVPWFDREANDAVLFGFLTAWLLGEYAAQCEDPPHILAHFH
EWLAGLGLVLCRQRHLPVATIFTTHATLLGRYLCAGNVDFYNNLAEFNLDKEAGDRQIYH
RYCLERAAVRCAHVFTTVSKITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFIRGHFYGHLDFNLDKTVFLFIAGRYEFSNKGADLFLEALARLNYLLRVNHSQV
TVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPEVSKML
DKEDFTMMKRAIFATQRQCLPPVCTHNMLEDSTDPILSSIRRIGLFNSSQDRVKVIFHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSSYGIYILDRRFRSVDESCNQLTSYLFQFCQQSRRQRIIQRNRTERLSDLLDWRY
LGRYYVSARHMALAKAFPESYAYEPQDLTSATGFRYPRPASVPPSPAHSLHSSPHHSEAE
DEDETYDEDLEAEKDRQNIRQPFSLPNKNKSLEGDLPEKN
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgtcacgcagtatctcagtgacctccctatcgggtctggaggagtgggacgag
gaattcgatttggaggatgcagttctgtttgaaatcgcatgggaggtggctaataaagtt
ggaggcatctacacagtgatccagacgaaggcgcgcttgacctgtgaggaatggggggaa
aactacttcttagttgggccatatatggagtccaatgtcaggacccaggttgaattgatt
gagcccccaaacccaacactgaggagaaccatcgacaagatgaacagtagtggctgcaag
gtatattttggccgttggctgattgaaggctctccgtatgtgatccttctggatgttggt
ttcaccgcctggtctctggaccgctggaagagtgaattatgggaaaactgtgccatcggc
gtgccctggttcgaccgcgaggccaacgatgctgtcctgttcggtttcctcaccgcctgg
ctgctcggagagtacgctgcgcaatgtgaagatcctccacacatcctggcgcactttcac
gagtggctggctggactggggctggtattatgccgacagaggcacttgcctgtagcgacc
attttcaccacacacgccacgctgctcggccgatacctttgtgcagggaacgtcgatttc
tacaacaacctagcagagtttaatttagataaggaggcaggtgatagacagatttatcac
cgctactgtttagagcgggctgcagtgcgctgtgctcacgtcttcaccactgtgtctaag
atcacagccatcgaagctgaacacttgctcaaaaggaaaccagacattgtgactcctaac
ggtctgaatgtgaaaaagttctcagccatgcacgagtttcagaatctacacgctcagagc
aaagctcgcattcaggagttcatcagaggccacttttatggacatttagatttcaacctg
gataaaaccgtgtttctcttcattgctggacgctacgagttctcaaataaaggagcggac
cttttcctcgaagcgttggccagactcaactatttactgagggtgaaccacagtcaggtt
acggtgatagcgttcttcatcatgcctgctcgcaccaacaacttcaacgtggagactctg
aagggtcaagccgtacggaaacagctctgggatacggcccagactgtgaaagaacgcttc
gggaagaaactctacgaatcgctgctagtagggcagctcccggaggtgtcgaagatgtta
gacaaggaggatttcaccatgatgaagagggccatctttgctacacagcgccagtgtctc
cctcccgtctgcacgcacaacatgctggaggacagcacggaccccatcctcagctccatc
cgccgcatcggcctcttcaacagctctcaggatcgcgtcaaggtcatcttccatccggag
tttctgtcctccacgtccccgctgctgcccatggactatgaagagtttgttcgaggctgc
catcttggagtctttccttcctactacgaaccctggggatacacaccagcggagtgcact
gtgatggggattccctccatctccactaatctctcagggtttggctgttttatggaagag
cacatagctgacccgtcttcttacgggatttatattctggaccggcggtttcgcagcgtg
gatgaatcatgtaaccagctgacctcctacctgttccagttctgccagcagagccgcaga
cagcgcatcatccagaggaaccgcacagaacgcctcagtgacctgctggactggagatat
ctgggtcggtattacgtatctgctcgtcatatggctctggctaaagccttccctgagagt
tacgcgtacgagccccaagatctaacctcggctacgggcttccgttacccccgtcctgcc
tcggtgccaccctcgcccgctcactcgctccattcgtcgccgcaccacagcgaggctgag
gacgaagacgagacctacgacgaagatctggaggctgagaaagaccgccagaacatccgg
caacctttcagtctgccaaataagaataaaagcctggaaggcgacctacctgagaaaaac
taa

DBGET integrated database retrieval system