KEGG   Ictalurus punctatus (channel catfish): 108257974Help
Entry
108257974         CDS       T04658                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2-like
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00590  Arachidonic acid metabolism
ipu01100  Metabolic pathways
ipu04370  VEGF signaling pathway
ipu04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108257974 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    108257974 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108257974 (PTGS2)
Enzymes [BR:ipu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     108257974 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF Phage_F hEGF
Motif
Other DBs
NCBI-GeneID: 108257974
NCBI-ProteinID: XP_017311658
UniProt: A0A2D0PYT8
LinkDB All DBs
Position
25
AA seq 607 aa AA seqDB search
MYMTGLLLLLSLGVLACEGADPCCSQPCQNRGVCTALGQDSYECDCTRTGYYGQNCTTPE
FLTWLKVTLKPSPNTVHYILTHFRAFWNIINNIPFLRDGVMRYVLTSRSHLIESPPTFNT
DYGYKSWEAYSNLSYFTRTLPPVPEDCPTPMGVAGRKELPDVKTVVEKFLVRKKFIPDPQ
RTNLMFAFFAQHFTHQFFKTDMKRGPAFTMAKNHGVDLNHIYGEDLERQHKLRLFKDGKL
KYKVLDGEVYPPLVSEVQVDMHYPAHVPAPQRFAVGHEAFGLVPGLMMYATIWLREHNRV
CDVLKQVHPDWDDERRFQTTRLILIGETIKIVIEEYVQHLSAYHFKLKFDPELLFNHRFQ
YQNRISSEFNTLYHWHPLMPDDFHIQDQVYSYKQFLFNTSIMTEHGISNLADSFSKQIAG
RFAGGHNVPPALTMVSTKSIENSRRMRYQSFNAYRKRFNMKPYASFEEMTGDKEMAAELE
ELYGDVDAMELYTGLLVEKPRPNAIFGETMVEMGAPYSLKGLMGNPICSPEYWKPSTFGG
EVGFDIINTASLQKLVCNNVNGPCPVVSFHVPDVKDTALTTINASTAHSGTNDVNPTILL
KERTAEL
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtacatgactggattgctccttcttttatccctgggtgtcctggcatgtgaaggagcc
gacccttgttgctcccagccatgccagaaccgtggtgtgtgtaccgctcttggtcaagac
tcttacgagtgtgactgcacacggaccggatattacgggcaaaactgtacaactcctgaa
ttcctcacatggctgaaagtgacgctgaaaccgtcaccgaacacggtgcactacatcctc
acgcatttccgcgctttctggaacatcatcaacaacattccgttcctgcgagacggtgtc
atgcgttatgttttgacgtcacgctcccatttaattgaaagtcccccaaccttcaacact
gactatggttacaagagctgggaagcctattccaatctatcctacttcacacggacgttg
cctcctgttcccgaggattgcccaacacctatgggagttgcaggtagaaaagagctgcct
gatgtgaagacggtggtggagaagttcctggtcaggaagaagttcatccctgacccacag
cgcaccaatctcatgttcgccttctttgctcagcacttcacacaccagttcttcaaaact
gacatgaagcgaggcccggccttcactatggccaagaaccatggggttgatctgaaccac
atttacggcgaggacctcgaacgtcagcataagctccgactatttaaggacggcaagcta
aaatataaggttctggatggcgaggtttatcctccgctagtcagtgaagttcaggtggat
atgcactatccagctcatgtgcctgcgcctcaacgcttcgctgtaggccacgaagctttc
ggtctggtcccaggcctcatgatgtacgctactatctggcttcgggaacacaaccgtgtg
tgtgacgttcttaagcaggtgcacccagattgggacgacgagaggcgctttcagaccaca
agactcatcttgattggtgaaaccatcaagattgtcattgaggaatacgtgcagcacctg
agcgcctaccactttaagcttaaatttgatccagagctcctgtttaaccatcgtttccag
taccagaaccggatctcgtccgagtttaacaccctttaccactggcacccgctcatgccc
gatgacttccatatccaagatcaagtctacagctacaagcagttcctcttcaacacctcg
atcatgacggagcacggcataagcaacctggccgattcgttctccaagcagatcgcaggc
aggtttgccggtggtcacaacgtcccgcctgcactgacgatggtgtcgacgaaatcgatc
gagaacagcagacggatgcgctaccagtctttcaatgcttacaggaaacgcttcaacatg
aagccgtacgcgtcgttcgaagagatgacaggtgataaggagatggcagcggagctggag
gaactgtacggagatgttgatgctatggagctgtacaccggtcttctcgttgaaaagcca
cggcccaacgccatctttggagagaccatggtggagatgggtgctccttactcactgaaa
ggcctcatgggaaaccccatctgctcgcctgagtactggaagcccagcacgtttggcggc
gaagtcggctttgacatcatcaacacggcctcgctgcagaaactggtatgcaataacgtc
aacgggccttgtcctgtcgtgtcttttcacgtgcccgacgtaaaggacacggcgctgacg
acaatcaacgccagcacggcacactcgggcacgaacgacgtcaacccgacaattctactc
aaagagcggaccgccgagctctga

DBGET integrated database retrieval system