KEGG   Ictalurus punctatus (channel catfish): 108258040
Entry
108258040         CDS       T04658                                 

Gene name
pdgfra
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
ipu04020  Calcium signaling pathway
ipu04144  Endocytosis
ipu04510  Focal adhesion
ipu04540  Gap junction
ipu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108258040 (pdgfra)
   04020 Calcium signaling pathway
    108258040 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108258040 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108258040 (pdgfra)
   04540 Gap junction
    108258040 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108258040 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ipu01001]
    108258040 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ipu04090]
    108258040 (pdgfra)
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108258040 (pdgfra)
Protein kinases [BR:ipu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   108258040 (pdgfra)
CD molecules [BR:ipu04090]
 Proteins
  108258040 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Izumo-Ig Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 108258040
NCBI-ProteinID: XP_017311769
UniProt: A0A2D0PZ57
LinkDB
Position
25
AA seq 1462 aa
MWILKTHLLLGVVLFGILQNVACELHHPFIVSDTNEFVLELHSMFNISCTGKKDVIWEEP
LPVNTHVLPGYYMTTLLIDGAEAHHTREYTCVYQSPDIEQANTEDIASIYIFVPDPQVPF
VPGDSTEVSRYNIPCRVTDPKSVVILRSLPSGVELPYHYEQKYGFLGYFPLGEYVCETVV
NGTTVPSVVYTVKDMSNMFNVPEKDFSVELTASQEEIKVGEAFNLTCTVPPGALYVQEWL
HLSKEAVGAIQKKETYPDKVLYILSIPHASTNDTGFYECSVTEQSSGKTHSSQVSIIVHE
GSFVILDHSGIGTIETIPFVEKAEFTIYIHSDGVPKVTWFKDDHVLNSNYIITTKTTLLG
DRRYESVLILRHPVEDDSGTYKITASLGSQRKEFSFKLYVEAGEPQITQPMLAPVIWPRN
KTMVVFLHSMFRLTCRGQAEVFWKGPVSLDKQKSDDKRGLFISTVTVDSATATHTGEYIC
LYKNENQTDKSSIYIFVPDPDMLFVPLPPYGHHVLKSPDEMEIPCRVSDPNAHVTLFHVE
TQQVLSTNYDSKKGFLGNFTPGTYVCQAIVDGEEHESDAYIVHGWTVGSGLHVELKAEKK
ALLVGETLIVNCVANGSDLLDQQWKYPGKMADRGKTTLKENKKDQEIYYTLTVPDARTKD
SGTYACSISDIMSNESQIKELTITVYEREFVSLDPMFGHVETAKLNDVQEFRVDIEAFPE
PKVTWWKDGVVLGDIAAEFTTSLQTINETRYQSTLTLIRAKAEDSGNYTVQAVIGNQAAS
YSFNLQVKVPAIIVDLLDLHHGSETGQAVVCIARGSPVPEVEWYICKNIKQCSNDSTEWS
PLQTNTTGITIDAHIDQDNQLESQVIFGHLENTLAVRCLARNEMVAVSREIKLVANGPHS
ELTVAAAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVIESVSPDGHEYIYVDPMQLPYD
TRWEFPRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMS
ELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRQAEKGKK
DLDIFGINPADESSRSYVILSFEEKGDYVDMKQADTMQYVPMLERSNASKYFDLQRDDYD
HPPSHKHINESEVEKLLSDDSERLTTMDLLSFTYQVARGMEFLASKNCVHRDLAARNVLL
SQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLW
EIFSLGGTPYPGMVVDSSFYNKIKSGYRMAKPEHASSDVYELMVKCWNNEPDKRPSFHSL
SESVATLLPCGYKRSYERVNNDFLKSDHPAVTRVQCVQSDETYLGVAYKNQCKMRERESG
FEEQRLSSDSGYIIPLPDLEPLSDEEYTKRNRHSSQTSEESAIETGSSSSTLPKREGETL
EDITLLDEMCLDSGDLVEDSFL
NT seq 4389 nt   +upstreamnt  +downstreamnt
atgtggatactgaagacacatctccttttgggggttgtcctctttggaatattgcaaaat
gtggcgtgtgaattgcatcatcctttcatcgtttcggacacaaacgagttcgtgttagag
ctgcactccatgtttaacatcagctgcacagggaagaaagacgtcatctgggaagagcca
ctaccagtcaacacacacgtgctgcccgggtattacatgaccacactgctgattgacggt
gccgaggctcatcacaccagagagtacacgtgcgtttaccagagcccagatatagagcag
gcaaacacggaggacatagccagcatctacatttttgtcccagaccctcaagttccattc
gttcctggggattcgacggaggtctcccggtataacattccttgccgcgttacagatccc
aaatctgttgtgattctacggagtctaccaagtggagttgagctcccatatcactatgaa
cagaagtatggatttcttggctactttcctcttggcgagtacgtgtgtgagaccgttgtg
aatggtacaacggtccctagcgtggtgtacacagtgaaggacatgtcaaatatgtttaat
gtgccggagaaggatttcagtgtggaactgacagccagtcaggaggaaataaaagtggga
gaagcttttaacctgacctgcacggttccacctggcgctctctatgtccaggagtggttg
catctcagtaaagaggctgtaggtgctattcagaagaaggagacctaccctgataaggtt
ttatatatcctcagtatcccacatgcctcaacgaatgacactggcttctacgaatgctca
gtcacagagcagtccagcggcaagacccactcctcccaagtatccatcattgtccatgag
ggttcttttgttattctggatcacagtgggattggaacaatagaaaccatccctttcgtg
gagaaggctgaattcaccatttacattcattctgatggtgttcccaaggtcacgtggttc
aaagatgaccatgtattgaatagtaattatataataacaaccaagaccactcttctagga
gacagaaggtacgagagtgttttaattctgcgacaccctgtagaagatgacagtggaaca
tataagattacagcgtcactcggctcacagagaaaagagttttccttcaaactctatgtt
gaagctggtgagccccagataacacagcccatgcttgctccggtaatctggcccaggaac
aagaccatggtggtgttccttcactccatgtttagactgacatgtcgcggccaagcagaa
gtgttctggaaaggtcccgtctcccttgacaagcagaagtcggatgacaagagaggcctg
ttcatttccacggtgactgtggacagtgctactgcaacacacaccggagaatacatctgt
ttgtacaagaatgagaatcagactgacaagagcagcatctacatctttgtgccagatccg
gacatgctgttcgtgcccctgccgccctatgggcaccatgtgctaaagagcccagatgag
atggagattccatgccgcgtgtctgatccgaatgctcatgtgacgctgttccatgttgag
actcagcaggttctgtccaccaactatgacagcaagaagggttttctaggcaacttcaca
cctgggacatatgtgtgtcaggccattgtggatggagaagagcatgagagcgacgcgtac
attgtccatggctggacagtgggctcagggctgcacgtagagcttaaggcagagaagaag
gctctgctggttggggaaaccctcattgtaaactgtgtagccaatggcagtgacttgcta
gatcaacaatggaagtatcctggaaaaatggcggatcgtggtaagacgacactaaaggag
aacaaaaaagatcaggagatctattacaccctgactgtgcccgatgctagaactaaagac
agtggaacttatgcctgttccatcagtgacattatgagcaatgagagccaaatcaaagag
ctcaccattactgtctatgagagggagtttgtatctctagatccaatgtttggccatgtg
gagacagccaaactgaacgatgttcaggagttccgggtggacattgaggcttttcctgaa
cctaaggtcacgtggtggaaggatggcgttgtattgggtgatattgctgcagagtttact
acctcccttcagacgatcaacgagacaaggtaccagagcactctcactctgattagagct
aaggctgaggacagtggcaattacacggtgcaagctgtgataggcaaccaggctgcaagc
tactcgttcaaccttcaggtgaaagttcctgctataatcgtggacctgctagacctgcac
catggctcagaaacaggccaggctgtggtgtgtatagccagaggatctcccgtccctgag
gtggagtggtacatctgtaaaaacattaaacagtgttccaatgactcaaccgagtggtca
cctcttcagaccaacaccactggcatcaccattgatgcacacatagaccaggacaaccag
ttggagagtcaggtgatctttggacatctggagaacacgctggctgtgcgctgcctggca
cggaacgagatggtcgctgtgtcccgtgagatcaaactggtggccaatggtccgcactca
gagctcactgtggcggctgctgttctggtgctgttggttattgtcatcatctccctcatt
gtgctggtcattatctggaaacagaagccacgttatgagatcaggtggcgggtcattgag
tcagtgagtccagatgggcacgagtatatctatgtggatcccatgcagctgccctacgac
acacgctgggaattcccacgtgatggccttgtccttggccgtattctgggctcaggggcc
tttgggaaggtggtggaaggcactgcgtatggactcagtcgttctcagccagtaatgaag
gtcgcagtgaagatgctcaaaccaacggctcgctccagtgagaaacaagcactgatgtca
gagctgaagatcatgactcacctgggcccccacctcaacattgtcaacctgctcggtgca
tgcaccaaatcaggtcctatctacatcattaccgagtactgtttttatggagacctggtg
aactacctgcataagaacagagacagcttcctgagccgacaggctgagaagggcaagaag
gacctggacatctttggcatcaatccagctgatgagagcagcagaagttatgtgatcctg
tcgtttgaggaaaaaggagactacgtggatatgaagcaggcagacacaatgcagtatgtc
cccatgttggagaggagcaacgcctccaaatacttcgaccttcagagagatgactatgat
caccctccctctcacaaacacatcaacgaaagtgaggtagaaaagcttctctctgatgac
tcagagcgcttgaccacaatggatcttcttagcttcacctatcaagtggccagagggatg
gagttcctggcctccaaaaattgtgttcacagagatttggcagctcgaaatgttctgctg
tctcaggggaagattgtgaagatctgtgactttgggctggccagggacatcatgcacgac
aacaactatgtgtccaaaggaagtaccttcctgccagtaaaatggatggcccctgagagc
atctttgataacctgtacaccactctgagtgatgtctggtcttacggcattttattgtgg
gagatcttttctctgggcgggaccccttatcctggcatggttgtggactccagcttctat
aacaaaatcaagagtggctacaggatggccaaacctgaacacgcttccagtgatgtttat
gagctgatggtgaagtgctggaacaatgagccagataagagaccctctttccacagtctg
agtgagagtgtggccaccctgctgccctgcggatacaagaggagctatgagcgtgtaaat
aacgacttcctgaagagcgaccacccggcggtgacccgcgtgcagtgtgtgcagagcgat
gagacctatttgggtgtggcctataagaaccagtgcaagatgagagagcgtgaaagcggc
ttcgaggagcagagactgagctcagacagtggctacatcatccctctgcctgaccttgaa
cccctttccgacgaagaatacaccaaaaggaaccgtcacagctctcagacatctgaggag
agcgctatagagaccggctcgagcagctccaccctgcccaagcgggagggagagaccctg
gaggacattacgctgctggatgagatgtgcctggactcgggagatctggtggaggacagc
ttcctgtga

DBGET integrated database retrieval system