KEGG   Ictalurus punctatus (channel catfish): 108258587Help
Entry
108258587         CDS       T04658                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETDB2-like
  KO
K18494  histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108258587
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ipu03036]
    108258587
Enzymes [BR:ipu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108258587
Chromosome and associated proteins [BR:ipu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108258587
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108258587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD
Motif
Other DBs
NCBI-GeneID: 108258587
NCBI-ProteinID: XP_017312789
UniProt: A0A2D0Q3C2
LinkDB All DBs
Position
26
AA seq 657 aa AA seqDB search
MELSAVERAKTFWSQVDVDLAFEELLGFLMCLREAIKNKAASDKGYVQGMNIIMESEVSL
TAALRSDSFEEVLIGEGVIVGEDILTVSVSDSHCTILKMKDLPVPEDALHDDVSRNLESG
SDNSQMSSSGRNDAMLLGKLDTYDYMMLLSPANVLSDDQLAPVSPVQLSYQQHDCSPACL
PHLPSHSDTFLGHNPLQVPLLCHFQRHCAKPLMLSPHEELDSNVLYKAPCGRSLRRMDDV
YQFLQQTKSLGVLHQTNFSFNSQVLPERQAQPRPLAPASPLPTTSISERDISRGIESVPV
TLCNDLDGVRPKEFRYRKDRWPHGCFLSTAPFFLSCCDCTDGCTDSSSCLCLQLSLKAGA
KPDRLYSHHRLNEPVSTGLYECGPWCGCPKSSCQNRVVQHGLRVRLQVFRTNDKGWGVRC
RDDLDKGTFVCTYAGVVLRLGRNLEEPLLSKIQKEEQLSDDEVEVVEEWTLPSGQKKTVT
ETLDTSPRPYVLVIQRPADQPSAPLDGQREQLENSDNQEEMNTCSSPNPSHTEIKHQHKE
EVVRKRLRLDGEENGGDVRRDQMVPKPDCQEKMYYLDASKEGNVGRFINHSCNPNLFVQN
VFVDTHDPKFPVIAFFTCKPIRAGTELTWNYSYKTGSDPEHEVQCLCGSNDCQTIII
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtcggctgttgagagagcgaagacattttggtctcaggtggatgtggacttg
gcttttgaggagctgttgggattcctgatgtgtctgagagaagctattaaaaacaaagct
gcctcggataaaggctacgtccagggcatgaacattatcatggagtcggaggtgtcgctg
actgcagctttgaggtctgattcctttgaggaggtgctgatcggtgaaggtgttatagtt
ggtgaagacatactgacagtgtctgtctcagactcgcactgcactatactgaaaatgaag
gatctacctgtgccagaagacgccttacatgacgatgtctcaaggaacctggagtccggt
tcagacaacagtcagatgtcttcatcaggtcgaaatgatgctatgttattagggaagtta
gacacgtatgactatatgatgctgctgtcgccagctaatgttttatctgatgaccagttg
gcccctgtgtcacctgtccagctttcctatcaacagcacgactgcagcccagcctgtctc
cctcacctcccgtctcactcggacacttttcttggccacaaccccttgcaagttcctctt
ctctgccacttccagcggcattgtgccaagccactgatgctttcaccacacgaggaactg
gactcgaacgtgctctacaaagccccgtgtgggcggagcttgcgccgcatggatgacgtg
tatcagttcttacagcagactaaaagcctcggggtcctgcaccagaccaacttcagcttc
aattcgcaggtactgccagagcggcaggcccagccaaggccgctagcccctgcttcacct
cttcccacaaccagtatttctgagagagacataagccgtgggattgaatctgtcccggtt
actctgtgtaatgacttggacggtgtacggccaaaagagtttcgctatcgcaaggatcgc
tggccccatggctgcttcttaagcacggcgccatttttcctgagctgctgtgactgcaca
gatggatgcacggacagttccagctgtttgtgtcttcagctgtctctaaaggctggcgca
aagccagaccggctttacagccaccaccggctaaatgagcctgtgtccaccgggctgtat
gaatgtggtccatggtgtgggtgcccgaaaagcagttgtcagaatcgtgtggtccagcat
ggactccgtgtccgcctgcaggtgtttcgcaccaatgacaagggatggggcgtgcgctgc
cgtgacgacctcgacaagggcacgttcgtctgtacttacgcaggtgttgtcctgagactc
gggcggaacttagaggagccgcttctctcgaaaatccagaaggaggagcagttgtcggat
gatgaggtggaggtagtggaggagtggacgcttccctcagggcagaagaaaacagtcact
gagaccctggacacctctccacgtccttatgttcttgtgatccagaggcctgcagaccag
ccctctgcaccgctggatggccagagggaacagctggagaattcggataaccaggaggaa
atgaacacctgttcatcgcctaatcccagtcatacagaaatcaaacaccagcacaaggaa
gaggtggtgaggaagaggcttcggttggatggcgaggaaaacggtggcgacgtacgtcga
gatcagatggtgcctaaacccgactgtcaggaaaaaatgtattatcttgatgcttcaaaa
gaaggaaatgtgggaaggtttattaatcacagctgcaatcccaacctctttgtccagaat
gtctttgttgatacccacgatcccaaattcccagtaattgctttctttacgtgcaagcca
atcagggcagggactgagctgacctggaattattcctataaaacaggaagtgatcccgag
cacgaggtccaatgtctgtgtggttcgaatgactgccaaacgattatcatctga

DBGET integrated database retrieval system