KEGG   Ictalurus punctatus (channel catfish): 108258846Help
Entry
108258846         CDS       T04658                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00052  Galactose metabolism
ipu00500  Starch and sucrose metabolism
ipu01100  Metabolic pathways
ipu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108258846
   00500 Starch and sucrose metabolism
    108258846
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    108258846
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ipu04147]
    108258846
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108258846
Exosome [BR:ipu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108258846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 108258846
NCBI-ProteinID: XP_017313279
UniProt: A0A2D0Q4Q3
LinkDB All DBs
Position
26
AA seq 951 aa AA seqDB search
MVSYKRLTPEEVNFSGVPLLQSHDDSQDSELKVEDAERPLLARRPQCSVTSALLTLGGFI
LVVLGVWLLGTVLWLRSTASIGIHRPPSPGKDNRTRLESCSVIPESWRFDCYPERGVVVT
EDLCHSRNCCFARAASEQSGVPWCYYPADFPSYTLAAINDTETGSIGKLVRTQKTYYPMD
IEVLRLDVLYESNSRLRVKITDPAQQRFEVPIDVPVVEKRAPNPLYTVEFSKQPFGIIVK
RTQTGAVLLNTTVAPLFYADQFLQMSTSLSSNFVYGLGEHRSNLVHDVQWSTFTMWARDA
APEELINLYGVHPFYLLMEADGLAHGSFLLNSNAMDIVLQPAPALTWRTIGGILDFYVFL
GPDPGSVVSEYLEVVGRPAMPVYWALGYHLCRWGYDSSNKTWEVVREMRNYGMPQDVQWN
DIDYMDRALDFTLDPLNFSTLPDLVKDLHLHSQRYVMILDPGISSTQPPGTYGPFEEGIK
NGVFINSSGGGTLIGKVWPGLTAFPDFSNPDTHEWWYRNLQEFHNRVAFDGLWIDMNEPS
NFFDGSVDGCPDDQLENPPYTPYVLGGSLRAKTVCASARQKTTSHYNLHSLYGLMEAKAT
ASALKRILAKRPFVISRSTFPSQGKYSGHWLGDNRSQWKDLYMSIPGVLTFNLLGVPLVG
ADICGFSQNTTEELCVRWTQLGAFYPFARNHNTKDSAPQDPTAFSPAARTAIKDALLLRY
SLFPFLYTLFHYAHVQGHTVARPLFFEFPTDGTTYTIDKQFLLGKSVLVTPVLEPGVDFV
VGYMPEGLWYDFYTGTSLVSKGEEMKLHAPLDKINLHLREGSIIPTQRPNTTLWVSSGQP
LHLIVCLSEDSQADGDLFWDDGESPDTYETGEYAYIVFSLKQNTMTSQVLRSHVEATYLT
VETVSFYGVKTAPSSVTVNSQEAPFNYTSNQVLRVDELGLNLSQNFTLSWK
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgtataagaggctgaccccagaggaggtcaacttctccggcgtgcctttactg
cagtctcatgatgattctcaggacagtgagctgaaggtggaagatgcagagcgccctctg
ctggcccggaggcctcagtgctccgtcacttctgccctgttgaccctaggaggctttatc
ctcgtagtcctcggtgtctggttactaggaaccgtgctttggctgcgtagtaccgcttcc
ataggaatccaccgccctccatcacccggcaaagacaaccggacacgactggaatcctgc
tccgttattccagaatcctggaggttcgactgctatccagagagaggtgttgtggtgact
gaggatttgtgtcactccagaaactgttgctttgcacgtgcagccagtgagcagagcggt
gtcccgtggtgctattatccagcagattttccatcgtatacgctagcggctattaacgac
accgagacgggatcgatcgggaaactggtccgtactcagaagacgtattatcctatggat
attgaggtgctgaggctggatgtgctgtacgagtcgaacagcagactgcgtgtaaaaata
acagatcccgcacagcagaggttcgaggttcctatagatgttcctgtggtggaaaaacga
gctccgaatcccttgtacacagtggagttctccaaacagccgttcgggatcatcgttaag
agaacacaaaccggagctgtgctgctgaacacgactgtagctccgctcttctacgcggat
cagttcctgcagatgtctacgtccttatcgtcgaatttcgtttacgggctcggtgaacat
cgctccaacctggtgcatgatgtgcagtggagcacgttcaccatgtgggctcgggatgca
gctccggaagagttgatcaacctgtacggtgttcatccattttatcttctcatggaggct
gatggactggcacatgggtctttcctgctcaacagcaatgctatggacatcgtcctgcag
cctgctccggctctcacctggcgcacgatcggcggaattctggacttctacgttttcctc
ggcccggatcccggctccgtggtttccgagtacctggaggtcgtaggaaggcctgcgatg
ccggtgtactgggcactgggttatcatctctgtcgctggggttacgactccagtaataaa
acctgggaggttgtgagagagatgaggaattatgggatgccgcaggatgtgcagtggaat
gatattgactacatggaccgcgctctggacttcaccttagacccgctgaacttctccaca
ctgcctgacctggtcaaggatcttcacctacacagccagcgttacgtcatgatcttggac
ccggggatcagcagcactcagccccccggtacgtacgggccgttcgaggaggggataaag
aacggcgtgttcatcaacagctccggcggaggaacgctgatcgggaaggtgtggccggga
cttacggcattcccggacttttccaacccggacacacacgagtggtggtaccgaaacctg
caggagttccacaaccgagtcgcgtttgacggcctgtggatcgatatgaacgaaccgtcg
aatttcttcgacggatccgtagacggttgtcctgacgaccaactagaaaaccctccttac
acaccgtatgttctgggcggcagtctgagggccaagaccgtgtgtgcgtctgcacgacag
aaaaccacctcacactacaacctgcacagcctgtacggacttatggaagccaaagcaaca
gcgagtgctttgaagaggatcctggcgaagcgcccgtttgtgatttcccgctccacgttc
ccgagtcaggggaagtactccggtcactggctgggagataacaggagccagtggaaggac
ttgtacatgtccattccaggcgtgctgacgttcaatctcctgggcgttccgctggtgggc
gcggacatctgcggcttttcccagaacaccacggaggagctgtgcgtgcgctggacgcag
ctcggagccttttaccccttcgccagaaaccataacacaaaagattcagcgcctcaggat
ccaacggcgttcagtccggccgctcggaccgcgataaaggacgctctcctgctccgttat
tccctctttcctttcctgtacacgctcttccactacgcgcacgtccagggacacaccgtg
gcgagacccctgtttttcgagttccctacagacggaacgacgtacaccatcgataaacag
ttcctgctggggaagagcgtgctggtgacgcccgttctggagcccggagtggatttcgtg
gttggctacatgcctgaggggctctggtacgatttttacacaggcacctcattggtcagt
aaaggtgaagagatgaagcttcatgctcctctggacaaaatcaacctccatctgagagaa
ggatccatcattcctacacagaggcccaacactacactgtgggtgagcagcggtcagccc
ctgcacttgatcgtgtgtctgagcgaggacagtcaggctgacggagatctcttctgggat
gacggagaatctccggacacgtacgagacgggcgagtacgcctacatcgtgttcagcctg
aaacagaacacgatgacgtcacaggtgctacgcagtcatgtggaggccacgtacctcacg
gtggagacggtttcgttttacggcgtgaagacggcgccgagcagcgtcaccgtgaattcg
caagaagcgccgttcaactacacgtccaatcaggtgttgagagtagacgagttgggtctg
aacctcagtcagaacttcaccctcagctggaaatga

DBGET integrated database retrieval system