KEGG   Ictalurus punctatus (channel catfish): 108259055Help
Entry
108259055         CDS       T04658                                 

Gene name
lig4
Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    108259055 (lig4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ipu03400]
    108259055 (lig4)
Enzymes [BR:ipu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     108259055 (lig4)
DNA repair and recombination proteins [BR:ipu03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     108259055 (lig4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_IV DNA_ligase_A_C BRCT_2 BRCT RNA_ligase mRNA_cap_enzyme THAP
Motif
Other DBs
NCBI-GeneID: 108259055
NCBI-ProteinID: XP_017313678
UniProt: A0A2D0Q4N6
LinkDB All DBs
Position
26
AA seq 918 aa AA seqDB search
MEGSSKGERTEETPKSDAASKTFVAAQVPFLDLCTVLENIQKAKHRPDKAKCLKDFLDSW
RRFHAALHKDNPNTTDSFYPAMRLIVPPFERERMAYGIKENMLAKLYIEVLGLPKSGPEA
NKLLNYRAPTTAKGESGDFALTAYFVLKKRCTSQGNLSIKEVNDFLDSVAINNASKQKDL
VKKSLLHLITQSSALEQKWLIRMILKDMKLGISKETVLQVFHSDAPELYNVSTDLERVCR
QLHDPSISLNEVSISLFSAFKPMLAAVANIRQVEKQMGNKPFYIETKLDGERIQLHKDGD
VYKYYSRNSYEYTQQFGSSPLEGSLTPYIHNVFKSHVVNCILDGEMMAYNFTTETFMQKG
SKFDVKRMVEDSDLQTCFCVFDVLLVNDQKFGNEPLKKRYDTLQTVFTPVKGRIQLVQYT
EAKTRQEVINALNEAIDNRDEGIMVKDPMSIYKPDKRGESWLKIKPEYVDGLMDELDLLI
VGGYWGKGRRSGMLSHFLCAVAETPSPGQKPTVFHTLCRIGSGYTMKELYELGLKLAKHW
KVFRKSSPPPGIWCGTEKPEVYIEPRNSVIIQVKAAEIVTSDMYKTNCTLRFPRIERIRE
DKEWYECMTLDELNQFRDKASGKLASKHFHFQEDEPEKRKRKLASKPKKTIGIVDHFKAQ
DLSTVTKETDMFEDVEFCVMSGSNTHSKAELEKAVACCGGIVVQNPGKDTYCVIAGVENV
RVKNLIGSNQHDVLQASWLLECVDRKQVLPWQPRHMIHMSPSTKEHFAKEYDCYGDSYYV
DTDEQQLRDVFSRMGTVDMDAVSIASIEQKYSWDDLPTSMFRPYRAYFDRCSDIGDPESL
IKFTCLDFRALEFCFHGGTVVERLEEGISHVVMAGEERLLDLRTHRRLFTKKFKIVRETW
VTESIKAGHVLNDNDYLV
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggagggctcatccaaaggtgagagaacagaggaaacacccaaaagtgacgctgcatct
aaaacatttgtggctgcacaagtgccatttcttgacctgtgcactgttcttgagaatatt
cagaaagccaaacatcggccagacaaggccaaatgcttaaaggatttcttagattcatgg
agaaggtttcatgcagctcttcacaaagataatcccaacacgacagattcattctaccca
gccatgcgtcttattgtgcctccttttgaaagggagagaatggcctatggtatcaaagaa
aacatgttagccaaactctacattgaggtcttggggcttccaaaatcggggccagaggca
aataaacttctcaattaccgagcgcctactacagccaaaggagaatctggagactttgcc
cttacagcttactttgtcctcaaaaagagatgcacaagccagggtaatctaagcatcaaa
gaggtcaatgacttcttggactctgtagcgataaataatgccagcaaacagaaagacctt
gtgaagaaaagccttttacatttgattacgcaaagctcagctttggaacaaaaatggctt
attcgtatgatcctgaaagacatgaaacttgggattagcaaggagaccgttctccaggtt
tttcactcagatgctccagagctctacaatgtctctacagacttggagagggtctgcaga
cagctacatgacccctctatttccttgaatgaggtgtccatcagcctgttttctgccttc
aaacccatgctggcagctgttgccaacatccgccaagtggagaaacagatggggaacaag
cccttctatattgagaccaagctggatggtgagcgcattcaacttcataaggatggggat
gtatacaaatactacagccgtaactcctatgaatacacgcaacagtttgggtcctcacca
ctagagggttccctcacaccatacatccacaatgtctttaaatctcatgttgttaattgc
atcttagatggagagatgatggcttataacttcaccacagagaccttcatgcaaaaaggc
agcaaatttgatgtcaagcgaatggtggaagactctgatttacaaacatgcttttgtgtg
tttgacgttttgcttgtcaatgaccagaagtttggaaacgagcctctcaagaagcgttac
gacactctccagacagtcttcacacccgtcaaaggccggatccagctggtacagtacact
gaagccaaaaccaggcaggaagtgataaatgccctcaatgaagctattgacaaccgtgac
gaaggcatcatggtcaaagatcccatgtccatctacaaaccagataaacgtggtgaaagc
tggctgaagatcaaacctgaatatgttgatggcctgatggatgaattggatttgctaata
gtgggaggctattggggtaaaggcagacggagtggaatgttgtcccactttctctgtgct
gttgctgaaacgccaagtcctggacagaagccaacagtgttccatacactctgtcgaatt
ggatcaggctacaccatgaaggagctctacgagcttggcctgaaactggccaaacactgg
aaggtttttcgcaagagtagccctccgccaggcatttggtgtgggacagagaagccagag
gtttacattgagccaagaaactcggtgatcattcaagtcaaagcggcggagattgttacc
agtgacatgtacaaaactaactgcactctgcgattccccaggattgagaggatccgagag
gacaaagaatggtatgagtgcatgaccttggatgagctaaatcagttccgtgataaagcc
tcgggtaagttggcatccaagcactttcacttccaggaagatgagccggagaagaggaaa
cggaaactcgcatccaagcccaaaaagaccattggcattgttgaccacttcaaagctcaa
gacctgtccactgtcaccaaagagactgacatgtttgaagatgtggaattctgtgtaatg
agcggaagcaacactcattccaaggccgagcttgaaaaggcagtggcctgttgcggaggc
attgtagtccagaaccctggaaaggacacatactgtgtgattgcaggtgttgagaatgtg
cgggtaaagaacctcatcggttcaaaccaacatgatgtattacaggcttcctggctcctg
gaatgtgtggacaggaaacaggtgctaccatggcaaccacgacacatgatccacatgtcc
ccttccacaaaggaacactttgctaaagagtatgactgctatggagacagttactacgtc
gacacagatgagcagcagctgagggatgtcttcagtagaatgggcactgttgacatggat
gcagtatccatagcttcaatcgagcagaagtacagctgggatgacttgcccactagcatg
ttcagaccttaccgtgcctactttgatcgatgttctgatattggagatccagaaagtctt
attaagtttacatgtctggactttcgggctctggagttttgctttcatgggggcacagta
gtagaaagactagaagaaggcatctcgcatgtagtcatggcgggagaagagcgattattg
gacctaaggacacacagacgcctctttactaagaagtttaagattgttcgagaaacatgg
gtgactgaatctattaaagcaggacatgtacttaatgacaatgattaccttgtgtaa

DBGET integrated database retrieval system