KEGG   Ictalurus punctatus (channel catfish): 108259239Help
Entry
108259239         CDS       T04658                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
ipu04210  Apoptosis
ipu04625  C-type lectin receptor signaling pathway
ipu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108259239
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108259239
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108259239
   04672 Intestinal immune network for IgA production
    108259239
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ipu01001]
    108259239
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     108259239
Protein kinases [BR:ipu01001]
 Serine/threonine kinases: STE group
  Other
   108259239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 108259239
NCBI-ProteinID: XP_017314012
UniProt: A0A2D0Q6T2
LinkDB All DBs
Position
2
AA seq 854 aa AA seqDB search
MAVEQRIFNSTRPFSMSTNQPKAKGHACLASSVEPQSPDTSGKGDKQHELMDYSKFIEVI
SHGTAKHVGTGPLGTEKPSFIAQAECESQDSQEFCPNSRHKNVYSNFRPALSLPQGSVSH
RQPRKKRRKRQRRRVSQREGQQRDGGSESVRDRRLTRVPQQDSGELGQCSYISSSAISTE
SLSVQETAEPSYTFHLGLSTPLSCKSWDRLFIPAHGLESYGQESECSPDPDSPLISEAEC
SLALAGLRNNVSQAECSFASAFAKQMVRDAKDREDEQEETEESYTNEGILFKEELQPQDY
EYREGRDYELCDFLKEGSFGLVYSIRDKTSGFVCAAKKVPLEHFRSEEVGSWSALQSPHV
LEFFGFVREGRSVFLFMDLKPGSLGQLLSERGRLPEDLSLHYMHQVLGALEHLHKRHILH
LDVKVDNVLLSEDGKNTFLCDFGESERLDVYGFSPFQALKGTETHMAPEVASGEKRCSKA
DVWSSCCMLLHMLNGCQPWTRYYSRPLYLKIAEEPPPLREIPPDCSPHTSDVIKRGLQRE
PSRRASAAELRVQTAKALKQLGGLRSPARGGAYQNPLGKPERCVPSPFSDSSVQQWMGPG
QENREQAGLSAEPKCHRQRVETLDDVKEENDREDEIVSRKESHLAPPSPLFPSPRPESHK
PTEQELRKLEREFFLSSLSQPHSVELQEQLLSCLGSDCLSSREAGDKKDSGRWSVGPGDD
LSSGVFSYNSQSDGQSFSMDWLGPAHQPPPRCFEGVDVCIRDFNGRCLRIRETPRAKVGH
IAIGISDQISESVFSLQSEDGSLVPHDKQVQEAGLFLRCVLAPDSAHVPRHRQGSCCNMP
WSWRIRDGRLETRN
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggaacagaggatctttaactccacccggcccttctccatgtccacaaaccag
ccgaaagcgaagggccacgcctgcctcgcgtccagcgtcgagcctcagtcgcctgacacc
tctgggaagggcgataaacagcatgagctgatggattattccaaattcatcgaggtcatc
tctcatggaacagccaagcatgtaggcacaggacctctgggaaccgagaaaccgtccttc
atcgcccaggcagagtgtgaatctcaggactcacaggaattctgtcccaacagcagacat
aaaaacgtgtacagcaacttcaggccagccctgtccttaccccaaggctcagtctctcac
cgccagccgaggaaaaaacgacggaagagacagcggcggagggtttcgcagagggagggc
caacagagggacggcgggagcgagagtgtgagagacagaagactcactcgagtgccacag
caggacagcggcgagcttggacaatgtagctacatcagcagcagtgcaattagcacagaa
agcctgtcagtgcaggagacagcggagccgtcctacacctttcacctgggcctcagcact
ccgctgtcttgcaaatcctgggaccgccttttcattcccgctcatggcctggaatcgtac
ggccaggagagcgagtgctcgccggaccccgactcgccgctcatcagcgaagccgaatgc
agcctggcactagcaggcctcaggaacaacgtctcgcaggccgagtgctccttcgcctcg
gcgttcgccaaacagatggtccgagacgcgaaggacagagaagacgaacaggaagagacg
gaagagagctacacgaacgaaggcatactctttaaagaggaactccagccacaggactat
gaatatcgagagggaagggattacgagttgtgtgatttcctaaaagaaggctcgttcgga
ttagtctacagcatcagagacaaaaccagcggctttgtgtgcgctgccaaaaaggtgccg
ttagaacatttcagaagtgaggaggtgggctcgtggagtgccctccagtctcctcacgtg
ctggaatttttcggattcgtccgagagggtcgatccgtcttcctgttcatggatctcaaa
cctggctctctggggcagttgttgtcagaaaggggtcgcctgcccgaggatctctccctg
cactacatgcatcaggtcctgggggcgctagagcacctgcacaagagacacatcctacac
ctggacgtcaaagtggataacgtgttgttgtccgaggatgggaaaaacacattcctgtgt
gactttggcgagtcagaacgactagacgtgtatggattcagccctttccaagctctgaag
gggacggagactcacatggctcctgaggtggcgagtggagagaagcgttgctccaaggcg
gacgtgtggagtagctgttgcatgctactgcacatgctcaatggctgccagccatggacg
cgctactactcccgccctctgtacctcaaaatagccgaagagccgccgcccctgagagag
ataccgcccgactgcagccctcatacctctgatgtcatcaaacggggactgcagagagag
ccgagccgaagagcgtcagccgcggagctcagagttcaaacagctaaagcacttaaacaa
ctgggaggtcttcggagcccagcaaggggaggagcctatcagaatccacttgggaaacca
gaaaggtgtgtgcccagccccttctccgatagctctgtgcagcagtggatgggcccaggg
caggagaacagagagcaggctggactgagtgctgagccaaaatgccatagacaacgagtg
gaaacactggacgacgtgaaggaggagaatgacagggaggacgagatcgtatcgagaaag
gagagtcacctcgccccaccttcaccgctctttccttctccacgccccgagtcccacaaa
cccacagagcaggagctccgcaaactcgagagggaatttttcctgagcagtctgtctcag
ccgcactcagtcgagctccaggagcaactcctttcctgcctgggtagtgactgcctttct
agcagagaggcaggagacaaaaaggactccggtcgctggtcagttggccccggggacgac
ctcagctcaggcgtgttttcctacaacagccaatcggacggacagagcttcagtatggat
tggcttggccccgcccatcagccgccacctcgctgctttgagggagtggacgtttgcatc
agggacttcaacgggcgatgcctccgtatccgggaaaccccgcgcgcaaaagtgggtcac
atcgccataggaatcagcgatcagatctcagagagtgtgttcagtctgcagagcgaggac
ggatccctggtgcctcacgataagcaagtacaggaagccggcctcttcttgcgctgcgtc
ctcgcccctgactccgcccacgtcccacgacacagacaaggctcctgctgcaacatgccg
tggagctggaggatcagagacgggaggttggagaccaggaactga

DBGET integrated database retrieval system