KEGG   Ictalurus punctatus (channel catfish): 108260083Help
Entry
108260083         CDS       T04658                                 

Gene name
lig3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu03410  Base excision repair
Module
ipu_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:ipu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    108260083 (lig3)
Enzymes [BR:ipu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     108260083 (lig3)
DNA repair and recombination proteins [BR:ipu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     108260083 (lig3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C RNA_ligase BRCT_2 mRNA_cap_enzyme Ribonuc_red_sm
Motif
Other DBs
NCBI-GeneID: 108260083
NCBI-ProteinID: XP_017315528
UniProt: A0A2D0QB60
LinkDB All DBs
Position
28
AA seq 1000 aa AA seqDB search
MHGLGFCKAARTLCRTFRLCQTQSTCPFLLQYCCPLIHAWGFALSARPPSRRFGLSSQAF
LAVSRATWQDERTTMAEQRFCVEYAKRGQAGCKKCKERIMKGLVRIGKIVPNPFSESAGE
MKEWYHVKCIFEKLERARATTKKIEDITDLEGWEELQDEEKELINKLVAELAAKANASPK
KKVQAKLNTSGQLSAPPADPTVNAPRKFSGFTATKAGPSSSSPGPSPAKASQGSTLSTQF
CQQDHKDCLFREFRKLCAMVAEKSSYNAKTEIIKDFLKKGSAGDKFKGDLYLTVKLLLPG
VVKSVYNLNDKQIVKLFSRILNCNQDEMVRDLTQGDVSETVRMFFEASNSFPPSTKSLLT
IQEVDASLTRLAQLTKEDEQQAELEDIAKKCTGNDLKCYIRLVKHDLKINSGAKHVLDAL
DPNAYDAFKASRNLGDVIDRVLRNQQEASNGGGPRKHLSVEATLMTPVQPMLAEACKSIE
YAMKKCPNGMYSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAHFKDFIPQAFAGGQ
SMILDAEVLLIDTKTSKPLPFGTLGVHKKAAFQDAQVCLFVFDCVYFNGVSLMDKPLCER
RKFLHDNMVEVPNRILFSEMKHVTRAADLAEMITRVIREGLEGLVLKDVKGAYEPGKRHW
LKVKKDYLNEGAMADTADLVVLGAFFGTGSKGGIMSSFLMGCYDPTTKKWCTVTKCSGGY
DDATLARLQKELDVIKIGKDPSKIPPWLKIVKNYYPDFLIRDPEKAPVWEITGAEFSKSE
MHTADGISIRFPRCTRMRDDKDWKTATNLPQLKELYRVSKERCDFEVTERPSTSSKDDKG
SSGGDSGGSSPSTSNGAASSKLAKNGHTPKRKPAKPVTPSPAKRKLPTEEHCAKKIKVET
FHDNGQSKATASPAKAADPQPEKTLLNIFTGVKLHLPESVQEFEKLRRYFVAYDGDLVPD
YDAASATHTLADPEEGSQAQKVSSNWIWQCVRKRRVVPPC
NT seq 3003 nt NT seq  +upstreamnt  +downstreamnt
atgcatgggctcggcttttgcaaggcagcaagaaccctctgcaggactttccgtctgtgc
cagacacaaagcacgtgtccgttcctcctgcagtactgttgccctctgatccacgcttgg
ggctttgccttgtcagcgagaccgccgtcgagacgcttcggtctctcatctcaggctttc
ctcgccgtctctcgggccacgtggcaggacgagcggacgaccatggctgagcagagattc
tgtgtggagtatgccaagcgaggccaggcaggctgcaaaaaatgcaaggagaggatcatg
aaggggctggtgcgcatcgggaagattgtgcccaacccgttcagcgagtctgcaggagag
atgaaggagtggtatcacgtcaagtgcatcttcgaaaagctggagcgtgcgcgggccacc
accaagaagatcgaggacattactgacctggagggctgggaagaattgcaggatgaggaa
aaagagctgatcaataagcttgttgcagaactggctgctaaggctaacgcaagtccaaag
aagaaggtgcaggccaagttaaacaccagcggccagttatcagctcctcctgctgatccg
acggtgaacgcgccacgcaagttttccggcttcacagcaacaaaggcaggtccatcttcg
tcgagtccagggccatcacccgcaaaagcgtctcagggcagcacgctgtccactcagttt
tgccagcaggaccacaaggactgtctgttccgcgagttccgcaagctctgcgccatggtg
gccgagaagtccagctacaatgcaaagacagagatcatcaaggacttcctaaagaagggt
tctgctggagacaagtttaaaggagatctctacctgacagtgaagctgctcctcccaggc
gtagtgaaaagcgtttacaacctcaacgacaagcaaattgtcaaactcttcagccgcatc
ctgaactgcaaccaggacgagatggtgcgcgacctaacacagggagacgtgtccgagacg
gtgaggatgttttttgaagccagcaactcgtttcctccttcaaccaagagtttgctgacc
atccaggaagtggacgcttcgctaactcgcctggctcagctcactaaggaagacgagcag
caggcagaactggaggacatcgcgaaaaaatgcactgggaacgacttgaagtgttacatc
cgtctggtgaaacatgatctgaagattaattccggtgccaaacacgtcctggatgcttta
gaccccaacgcctacgacgccttcaaagcctctcgaaacctcggcgacgtgatcgacaga
gtcctgcgcaatcagcaggaggcatcgaacggcggcggcccgaggaagcacttgagtgtc
gaggccacacttatgacccccgtgcagcccatgctggccgaagcctgcaagtccatcgag
tacgccatgaagaagtgccccaacggaatgtactctgagatcaagtacgacggcgagcgc
gtgcaagtgcacaagaacggtgaccacttcagctacttcagccgcagcctcaaacccgtg
ctgcctcacaaggtggcccattttaaagacttcataccgcaggcttttgccggaggccag
agcatgatcctagatgctgaggttcttctgattgataccaagaccagtaagcctctgccg
ttcgggacgctgggagttcacaaaaaagcggcgtttcaagacgcacaagtgtgcctgttt
gtttttgactgcgtttattttaacggtgtcagcctcatggacaagccgctttgtgagaga
agaaaatttcttcatgataacatggtggaggttccgaacaggattctgttttcggagatg
aagcacgtcacgagagctgctgacctggcggaaatgatcacgcgagtcatcagagaagga
ctggaaggactcgttctgaaagatgtcaagggggcgtatgaacctggtaaacgtcactgg
ctgaaggtgaagaaagattacctgaatgaaggtgcgatggcagacacggccgatttagtg
gtcctgggggcgtttttcggaaccggctcaaaaggtggaatcatgtccagtttcctcatg
ggctgctacgatcccacgacaaaaaaatggtgcacagtgacgaaatgctccggaggctat
gacgacgccacgctggccaggctgcagaaggagctggacgtcattaaaatcggcaaggat
cccagcaagattccaccctggctaaaaatagtcaagaactactatccagattttctcatc
cgagatcctgagaaagccccagtttgggagatcacaggagccgagttctccaagtcagaa
atgcacaccgctgacggcatctccatccgatttccgcgatgcactcgtatgcgtgatgat
aaggactggaagacggccaccaaccttccccagctcaaggaactttaccgcgtttcgaag
gagaggtgcgactttgaggtgaccgaaaggccgtctacaagcagcaaagacgacaaaggc
tcgtcaggaggagacagcggaggcagctcaccgtccacctccaatggagcagcaagctca
aagctagccaaaaatggtcatactccaaagcgaaagccggcgaaacccgtaactccatcc
cctgccaagaggaagctgcccactgaggaacactgcgcaaagaagattaaggtcgaaaca
tttcacgacaacgggcaaagcaaagcaaccgcttctccagctaaggctgctgacccgcag
cctgaaaagactctgctgaacatcttcaccggcgtaaaactgcacctcccagaatcggtg
caggagtttgagaagctgcggcgctactttgtggcgtacgatggcgatctcgttccggat
tacgacgctgcgtctgcgacacacacgctagccgaccccgaggagggcagccaggcgcag
aaagtcagctccaactggatctggcagtgcgtaaggaaaagacgagtggttcctccctgc
tga

DBGET integrated database retrieval system