KEGG   Ictalurus punctatus (channel catfish): 108260779
Entry
108260779         CDS       T04658                                 

Definition
(RefSeq) putative transcription factor p65 homolog
  KO
K04735  transcription factor p65
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
ipu04137  Mitophagy - animal
ipu04210  Apoptosis
ipu04218  Cellular senescence
ipu04620  Toll-like receptor signaling pathway
ipu04621  NOD-like receptor signaling pathway
ipu04622  RIG-I-like receptor signaling pathway
ipu04623  Cytosolic DNA-sensing pathway
ipu04625  C-type lectin receptor signaling pathway
ipu04920  Adipocytokine signaling pathway
ipu05132  Salmonella infection
ipu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108260779
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    108260779
  09143 Cell growth and death
   04210 Apoptosis
    108260779
   04218 Cellular senescence
    108260779
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108260779
   04621 NOD-like receptor signaling pathway
    108260779
   04622 RIG-I-like receptor signaling pathway
    108260779
   04623 Cytosolic DNA-sensing pathway
    108260779
   04625 C-type lectin receptor signaling pathway
    108260779
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108260779
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108260779
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108260779
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ipu03000]
    108260779
Transcription factors [BR:ipu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    108260779
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 108260779
NCBI-ProteinID: NP_001316185
UniProt: V5RLP3
LinkDB
Position
29
AA seq 601 aa
MAERFNWGQPTVQQGSPYIEIIEQPKARGMRFRYRCEGRSAGSIPGEKSNDSTKTHPAIK
VHNYSGPIRVKISLVTKNPPYKPHPHELVGKDCKHGYYEADLPERRVHSFQNLGIQCVKK
KDVAEAVSCRLQTQNNPFNIPEAKVWEEEYDLNAVRLCFQATITLATGELYALEPVISQP
IYDNRAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFFRDSWESKGSFSQA
DVHRQVAIVFRTPPYCDTNLTEPVRVKMQLRRPSDREVSEPMDFQYLPADPDEYRLMEKR
KRTEGMLQNLKLSNIMPDATAARKSITAIRTLPAPKPLATASAPPVVNPVPCMGPVRPPS
LFNTPAPGLLFTQSQTESTPSNGDGWKFFTNVKVQPSAVPAPSVAQDFRTVNLSDLHGFS
FPTFPPSVPDQSDSGSRRDGTGANGAGTMVTQEVQNTYASSISLMDNEIPEFPSFSEAQT
SDVENINTDDFQALLGQSGDGTLATSVCHANAAGSMAVDNALGSSGAEQAARNLGNGTWM
SFPQSIINFLQNEPMPDEGMAGTSAVPDTLDDLDFPSLDEDRLMSMLNSGNQVSFLSGHP
T
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggctgaaaggttcaactggggacagcccactgtgcagcaaggctcgccgtacatcgag
atcatcgagcagcccaaggcgagagggatgcgcttccgttatagatgcgaggggagatca
gctggaagcatacccggcgaaaaaagcaacgattccaccaaaacacacccagccatcaag
gtgcataactacagcggcccaatcagagtgaagatctccttggttaccaagaacccgccg
tacaagccgcacccacacgagctggtgggaaaagactgtaaacacggctactacgaagct
gacctgcccgagagacgggttcacagtttccagaatctcggtattcagtgtgtgaagaag
aaggatgtggccgaagccgtttcctgtcgcctgcagacacagaacaacccttttaacatt
cccgaagccaaagtgtgggaggaggagtacgacctgaacgccgtccgcctctgtttccag
gcaaccatcaccctggcaaccggcgagctgtacgctctggagcctgtcatctctcagccc
atctacgacaacagagctccgaacacagccgagctaaagatctgtcgcgtgaacaggaac
tctggcagctgccggggcggagatgaaatcttcctactgtgtgacaaagtgcaaaaagag
gacatcgaggtgcgcttcttccgagactcgtgggaaagtaaaggctcgttctctcaggcc
gacgtccacaggcaggtcgccatcgtgttccgcacgccgccctactgcgatacgaacctg
acggagccggtgagagtgaagatgcagctccgcaggccgtcagaccgcgaggtcagcgag
cccatggacttccagtatctccccgccgacccagatgagtacaggctgatggagaagagg
aagcggacggagggaatgctccagaacctcaaactgagcaacatcatgccagatgccacc
gctgcgaggaaaagcataactgccataagaacacttccagctccgaaacccctggctact
gccagtgctccaccagtggtgaatcctgtgccatgcatgggtccagtgaggcctccgtct
ttgttcaacactcccgctccaggccttctgttcactcagtcccaaaccgagtcgacgccc
tctaacggagacggatggaagtttttcaccaacgtcaaagtgcagccttctgccgttcca
gctccgtccgtcgctcaagacttccgcacggtcaatctctccgacctgcacggcttctcc
ttccctacgttccctccctccgttccagatcaatccgactcgggcagcaggagggacgga
accggggctaacggagctggtaccatggtgacccaagaggtccaaaatacgtacgcctct
tccatcagcctgatggataacgagattcctgagttcccgagcttttccgaagcccagacg
tcagacgtggagaacatcaacactgacgattttcaggcgctgctgggccaaagcggagac
ggcactttggctacttccgtatgtcacgccaacgcggcaggaagcatggccgtcgataac
gcgctgggttccagcggtgccgagcaggcggcgagaaacctgggcaacggaacctggatg
agtttcccacaaagcatcattaactttctgcagaacgagccgatgccggacgaggggatg
gccggcacatcagccgtacctgacaccctcgacgacttagacttcccctccctagacgag
gatcgcctcatgtccatgttgaacagcggcaaccaagtcagcttcctgtccgggcatccc
acttag

DBGET integrated database retrieval system