KEGG   Ictalurus punctatus (channel catfish): 108260916Help
Entry
108260916         CDS       T04658                                 

Gene name
gaa
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00052  Galactose metabolism
ipu00500  Starch and sucrose metabolism
ipu01100  Metabolic pathways
ipu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108260916 (gaa)
   00500 Starch and sucrose metabolism
    108260916 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    108260916 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ipu04147]
    108260916 (gaa)
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108260916 (gaa)
Exosome [BR:ipu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108260916 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 108260916
NCBI-ProteinID: XP_017317133
UniProt: A0A2D0QFQ7
LinkDB All DBs
Position
2
AA seq 936 aa AA seqDB search
MMIQFGLPHSTYILLTLALSCILISQLYLHQTSTVRVPSSPEFTAIKVPKARDLFKNNTR
NVSNNQNSSELPNHSTVAGRNCGLPVEKRFDCARDRTVAQAECEERGCCYLPLPQSEYSG
PPWCFYPASYPGYRMGPLSPTPRGQSATLTRITPSYLPRDISTLQLEVMEEEAGRLHLTL
KDPSSTRYEVPFVRVPSSRRTDMQDFLYDVDFQSDPFGFVVRRRSNGRVLLNTTVAPLLF
ADQYLQLSTSLASTFISGFGEHYTHLTLDLNWTSVTLWNRDMAPHSNANLYGSHPFCLVQ
EGDGQAYGIFLLNSNAMEVALQPMPALTWVTIGGILDIYIFLGPDPQSVVRQYHEVIGYP
MMPPYWSLGFHLCRWGYTSTIMTRAVVQRMQQAHFPLDVQWNDLDYADKKRVFTFDPQRF
GDLPEMVQEFHEQGLKYVLIVDPGISSTSPPGSYKPFDDGQQRGVFIKNLTGQTLIGKVW
PGPTAFPDFTNPDTVSWWEECIRDFHANVSLDGLWIDMNEPASFVQGSVHGCPNTDLESP
PYTPDVIGGQLNSGTLCMNSQQALSSHYNLHNLYGLTEAIATYSALLKARGSRPFVLSRS
SFPGLGRFSGHWTGDVRSDWEQLRYSIPAVLLFGLYGVPLVGADVCGFEGDTNEELCVRW
TQMGAFYPFMRNHNDRPNAPQEPYVFGQQAQAAMRNVLMLRYALLPYLYTLFHHAHTSAS
TVARPLFMEFPSDPNCLKIDRQFLWGSSLLISPVLDQGVVDLAAYLPPAMWYSLHNGQPY
NSKGQYLLLPAPLDTINVHVRGGYIIPQQVPALTTSASRSNPFVLTVALCSQGQAKGELF
WDDGDSLDTFERGDYSYVSFMAEQSQLVGEPLKLNGALDGLVVGEVRVFGVPTPPTGVWA
NGKQVRDFSYTTDTKVLTVSNLALLISETFTVQWSL
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgatgattcagtttgggcttccacattcaacttatattcttttaactctggcactatca
tgcatactgatcagccagttgtatcttcaccaaacatcgactgtaagagtgccatcatcc
ccagagttcacagcaataaaagtgccaaaggccagagatctgttcaagaacaacaccagg
aatgtttcaaataatcaaaattcaagcgaattaccaaaccactccactgttgctggaagg
aactgcggtcttcctgtggagaaacggttcgattgtgcccgcgatcgaaccgttgctcag
gcggagtgtgaggaacgaggctgttgctacttgcccctaccccagtctgagtacagtggg
ccgccatggtgcttctaccctgcgtcatatcctggctaccgaatgggaccgctttctccc
acacctaggggtcagtcagccacccttactcgcatcacgccttcttacctgccccgagac
atctccactctgcagctagaagtgatggaggaggaagcaggccgcttacaccttactctg
aaggatccctcatcaactcgatatgaagttccctttgttagagtgccatccagtagacgt
acagacatgcaagacttcctctatgatgtggactttcagtcagacccattcggctttgtg
gtgcgtcgcagatccaatggccgagtgctactgaacaccactgtagcaccgctcctgttt
gcagaccagtacctgcaactctccacctctctggcatctactttcatctctggatttggg
gagcactacacacacctgacgctggatctcaactggacctctgtcactctgtggaacaga
gatatggcaccacatagcaatgccaacctttacggttcccatccattctgcttagttcaa
gagggtgatggtcaggcttatggcatcttccttcttaatagcaatgcaatggaagtagca
ctgcagcccatgccagcactgacctgggtgaccatcggaggaattctggacatctacatc
ttcttaggccctgatccacagagcgtagtccgccagtaccatgaggttattggttatccc
atgatgcctccttattggtctttggggttccacctctgccgatggggctacacctccacc
attatgaccagagctgtggtgcagcggatgcagcaagcccattttcctctcgacgtgcaa
tggaatgatcttgattatgctgacaagaagcgagtcttcacctttgacccacagaggttt
ggagacttgcctgagatggtgcaagagttccatgagcagggactgaagtatgtgcttatt
gtggatccaggcatcagtagtacgagtcctccaggttcatacaaacccttcgatgatgga
cagcagcggggtgttttcatcaaaaacctgacaggacaaacacttattgggaaggtatgg
cctggaccaacagcattcccagacttcactaatccagatacagtgagctggtgggaagag
tgcatcagagacttccatgccaatgtgtcacttgatggcctctggatagatatgaatgaa
cctgctagttttgttcagggttcggtgcatggatgcccaaacacagacctagagagtcca
ccttatactccagatgttataggaggtcagttaaactcgggcactctgtgtatgaacagt
caacaagcattgtcttctcattacaacctacacaacctgtatggactgactgaggctatt
gccacctacagtgcgttgctgaaagcaagaggctctcggccgttcgtgctctcccgctcc
tctttcccaggactgggccgtttctcaggtcactggacaggagatgtgcgtagtgactgg
gagcaactgcgatactctatccccgctgtgctgctgttcgggctgtacggggttcctctg
gttggggcagatgtgtgtggattcgaaggcgacactaacgaggagctgtgtgtgcgctgg
actcagatgggtgccttctatccattcatgaggaaccacaatgatagacctaatgctccc
caggagccttatgtatttggacagcaggcccaggcagccatgaggaatgtgctgatgctc
agatacgctcttctaccctacctgtacacacttttccaccatgcacacacctcagccagc
actgtagcaagacccctctttatggagttcccatctgatccaaactgtctgaagatagat
aggcagttcctgtgggggagttctctgctcattagtccagtcctagatcagggagttgtg
gatttggcagcgtatctcccccctgcgatgtggtatagtctgcacaatggccaaccttac
aacagcaagggccagtacctgctccttccagctccactagataccatcaacgtccatgtg
agagggggctatattattccacaacaggtgcctgcattgacaacctcagcctcacgcagt
aaccccttcgtcctgacggtggcactctgctcacagggccaggccaaaggggagctgttc
tgggacgacggggacagcctagacacatttgagcgtggagattactcatatgttagcttc
atggcagaacagtcacagctggtgggtgagccattaaaactgaatggagctctggatggt
ttagttgtgggagaggtgcgtgtgtttggagtgccaactcctcctacaggagtgtgggct
aatgggaaacaagtgagggatttctcttacaccacagacaccaaggttcttacagtgtcg
aatctggccctgctgatatcagagacattcacggtgcagtggagtttatga

DBGET integrated database retrieval system