KEGG   Ictalurus punctatus (channel catfish): 108262286Help
Entry
108262286         CDS       T04658                                 

Gene name
pcsk2
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 2
  KO
K01360  proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ipu01002]
    108262286 (pcsk2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ipu03110]
    108262286 (pcsk2)
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     108262286 (pcsk2)
Peptidases [BR:ipu01002]
 Serine Peptidases
  Family S8: subtilisin family
   108262286 (pcsk2)
Chaperones and folding catalysts [BR:ipu03110]
 Intramolecular chaperones
  Subtilisin family
   108262286 (pcsk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain
Motif
Other DBs
NCBI-GeneID: 108262286
NCBI-ProteinID: XP_017318323
UniProt: A0A2D0QIS6
LinkDB All DBs
Position
3
AA seq 641 aa AA seqDB search
MLGTVKYGTAVALLLFTALLFFTGATEEGIFTNHLLVQLHEGGNEDAHQLALEYGFGSAR
QLPFGERLFHFYPRDPPKTKRKRSLRRHQHLDEDRRVKKVILQAGFERQKRGYRDINDFD
IGLNDPLFTKQWYLINTGQADGTPGLDLNVAEAWKMGYTGKGVTIAIMDDGIDYLHPDLA
SNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAVANNNICGVGVAYHSKVAGI
RMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRG
GKGSIYVWASGDGGGYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNG
RKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALSLEANPNLTWRDMQHLTVLTSK
RNKLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVSLARDWKTVPERFHCVAGSVQETHK
IQSGAKLVLTITTDACQGRENFVRYLEHVQAVVTVNASRRGELTLNLTSPMGTKSILLSR
RPRDSDSTVGFDKWPFMSTHTWGEDPRGTWKLEVGFSGESPQSGHLNEWTLMLHGTQSAP
YIEQVVRDYQSKLAMSKKEELEEELDEAVERSLERMMSKSN
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgctcggaaccgtgaaatatgggacagcagtcgctctgctgttgtttactgcattgctc
ttcttcaccggagccactgaggagggaattttcacaaaccatcttttagtgcaattacac
gagggagggaatgaagatgcacaccaacttgcacttgagtatggctttgggagtgccaga
cagcttcccttcggcgagagactttttcatttctacccccgggaccctcctaaaacgaag
aggaaacgcagtcttcgtcgccaccagcatctggatgaggaccgacgggtaaaaaaagtg
attctacaggcgggattcgaacgtcagaagagaggctatcgagacatcaatgactttgac
atcggtttgaatgatccactttttaccaagcagtggtaccttataaatacagggcaggcg
gacggcacccccgggctggacctcaacgtggctgaggcctggaagatgggctacactgga
aaaggagtgaccatcgccatcatggatgatggtatcgattatttacacccagaccttgcg
tccaattataatgcagaggccagctatgacttcagcagcaatgacccatacccataccct
cgctacacggatgattggtttaacagtcatggaaccagatgtgccggagaggtgtctgca
gtggccaacaacaacatctgtggtgtaggagtggcctaccattccaaagtggcgggcatc
cgaatgttggaccagccattcatgacggacatcattgaagcctcctccatcagtcacatg
ccgcaggttattgacatctacagtgctagctggggtcccactgacgacggaaagacggtg
gatgggcctcgtgagctaacccttcaggccatggcagatggcgtcaacaagggccgaggg
gggaaaggcagtatctatgtgtgggcttcaggcgatggtggtggctatgatgactgcaac
tgtgatggctatgcctccagcatgtggaccatctccattaattcggccattaacgatgga
cgcacagctttgtacgacgagagctgctcctccacactcgcctcgacgttcagtaacggc
cgtaagaggaaccccgaggcaggagtggccactacagatctgtatggaaactgtacattg
cgtcattcaggcacatcagctgctgctcccgaggctgctggcgtgtttgccttgtcatta
gaagccaatccaaacctgacctggagggacatgcagcacctcacagtactcacttcaaag
aggaataaactccatgatgaggtgcaccagtggaggagaaacggcgtgggcttggagttc
aaccatctgttcggctacggcgtgctggatgccggtgccatggtcagcctggcacgtgac
tggaagactgtgcctgagcgttttcactgtgtggccggatcagtgcaggagacacacaag
atccaatcaggtgctaagctagtgctcaccatcactacagacgcatgtcagggccgggaa
aactttgtgcgctatctggagcatgtccaggcggtggtgacagtgaacgcgagccggcgc
ggagagctcacgctcaacctgacctcacccatgggcacgaagtccatcctgctgagccgg
cggccacgtgactccgactccactgtggggttcgacaagtggcccttcatgagcacgcac
acatggggcgaggaccctcgtggcacttggaagctggaagtcggattcagcggagaatct
ccacagagcggccatctaaacgagtggaccctcatgctgcatggcacacagagtgcgccc
tacatagagcaagtggtcagggactaccagtccaaattagccatgtccaaaaaggaggag
ctggaggaagagctggatgaagccgtcgaaaggagccttgagaggatgatgagcaaaagc
aactag

DBGET integrated database retrieval system