KEGG   Ictalurus punctatus (channel catfish): 108262651Help
Entry
108262651         CDS       T04658                                 

Gene name
ret
Definition
(RefSeq) ret proto-oncogene
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ipu01001]
    108262651 (ret)
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108262651 (ret)
Protein kinases [BR:ipu01001]
 Receptor tyrosine kinases (RTK)
  RET family
   108262651 (ret)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RET_CLD3 RET_CLD4 RET_CLD1 Cadherin RIO1 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 108262651
NCBI-ProteinID: XP_017318481
UniProt: A0A2D0QL82
LinkDB All DBs
Position
3
AA seq 1114 aa AA seqDB search
MGRTRAIKLWRDTVLVLLLLWEGSWGLYFPQTTYSESIYVGQAAGTPVLQVHAMQERASE
QPYFCLYRMPVLKPAAYGSWFHIDTVTGVIYMNKTLDWTDFESIYSSRPVQKGKETMKLT
LKVSVDVMSPKKLCSQITNVDVSFTFINATAPTCGKMTLEKLCFPDEVIKPHIKENRMPG
TMRQLRRFTHADLCPNYTISYRVEAESPVPFVVNDTTSELVVTAPVDREEKEVYHLMIVC
LVRTEETLDTLTNSLHITIYDEDDSPPYVNGTDTEDVLIEFSRSKDTTFGNLFVYDRDTT
TYQSQDNYVSTLMTNDSWIKDTFTIEQKFSEEKSIFGNVRGTVYKYKLRLNRNISVDEKR
SFQLDYLISDTMFRGPEGTVMLHFNVTILPVPIRFSNITYFFVLSRKSMTYSQIGKVCVD
NCLKFKGIEIAYHLELGDRNISANVQSCYTAVDVARNLEDMSGVLYVNDTEPLLRPECQE
LQYALVAHEQHKQLQAKAIVIIIFEGEVDPLRTEGQRSLACAEKRQRGECETFRGLGTPT
GRCQWRQGTGKVISKNYSTCSPDLRTCPNGYCDVIESKNISICPQDCTREPIIGGHEKGL
MLGIKAGHGTCYCYSEKCFCEQDYLQENICDDMCKTVIATAVLLSFIVSILLSSYFIHRY
HKSTPKPPIASAEMTFRRPAQSYPISYSANNVRRGSLDSMENQVAIDTFKIPEDPKWEFP
RKNLVLGKTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENASHGELRDLLSEFTLLK
QVNHPHVIKMYGACSQDGPLYLIVEYAKYGSLRNFLRESRKVGPSYMGGDANRNSSYLEN
PDERALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVY
EEDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIAPERL
FNLLKTGYRMEKPENCTEEMYSLMLRCWKQEPDKRPTFSEISKELEKMMVKSRDYLDLAA
STPADALLYDDTLSEEDTPLVDCNNTPLPRTLPSTWIENKLYGMSYPNWPEKSPVLLNRL
DATNPEFTRYANDSVYANWMALPSPAKVMDKLDS
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atgggtaggacgcgggccattaagctgtggagggacaccgtcctggtcctcttgctcctc
tgggaaggctcctggggactgtattttcctcagaccacatactccgagagcatctatgtt
ggccaggcagcaggtacaccagtgctgcaggtgcacgccatgcaggagagagcttcagag
cagccatacttctgcctgtacaggatgccggtcctgaaacctgctgcttacggatcatgg
ttccatatcgacactgtcacgggagtgatctacatgaacaaaactctggattggactgac
tttgagtcaatatatagcagcaggcctgtgcaaaaaggcaaagagacaatgaaattgacc
ctgaaagtgtcagtggacgtcatgtctccaaaaaagctgtgctctcagatcactaatgtg
gatgtcagttttacattcatcaatgccacagcgcccacctgtggcaagatgacgctagag
aaactgtgcttccctgatgaagtcataaaaccccatatcaaggagaaccgcatgcctgga
actatgcgccagcttcgtcgctttacccatgctgacctgtgccccaactataccatcagc
tacagggtggaagcagagtctccagtgccatttgtagtcaatgacaccacttctgagctg
gtagtcacagcacctgtagaccgtgaggagaaggaggtctatcatctcatgatagtatgt
ttggtccggacagaagagacattggacactcttactaattccctgcatatcactatatat
gatgaggatgacagtcccccctacgtgaatggcacggacactgaggacgtgcttatagaa
tttagccgcagcaaggacactacatttggcaacctgtttgtttacgacagagacacaact
acctatcagagccaggataattatgtatcgacgctaatgactaatgactcctggattaaa
gacacatttaccattgaacagaaattcagtgaggaaaagtccatcttcggcaatgtgcga
gggacagtctataagtacaagttgcgtctcaacaggaacatttcagtggatgagaagcgc
tcgtttcagttggattatctaatcagcgacactatgtttcgtggccctgagggaactgtg
atgctgcatttcaatgttaccattttgccagttcctattaggttcagtaacatcacctac
ttctttgtgctctctcggaaatccatgacctactcccagattggtaaagtatgcgtggac
aactgcctgaagttcaagggtattgaaattgcataccatttagagttgggtgacaggaac
atctcggctaatgttcagtcctgctacacggcagttgatgtggcccggaatctggaggac
atgtctggtgttctctatgtaaacgacacagagccactgctcaggcctgaatgtcaagag
ctgcagtatgcgcttgttgctcatgaacagcataagcagcttcaggcgaaagcaatagtc
atcataatttttgaaggcgaagtggatcctttaaggacagagggacaaagatctctggcc
tgtgcagagaagagacagcgtggggagtgtgagacattcagaggcctgggaactcccact
ggaagatgtcagtggagacaaggcacaggaaaagtgatatcaaaaaattactccacttgt
tctccagacctgcgtacatgtccaaatggctactgtgatgtgattgaaagcaaaaatata
tccatatgtcctcaggattgcacccgtgagccaattattggaggccatgagaaaggcctg
atgcttggcattaaggcaggacatggaacctgctattgctattcggagaagtgcttttgt
gagcaagattatttgcaagagaatatatgtgatgatatgtgtaagactgtcatagccact
gcagtccttctttccttcatcgtctccatcctcctttcttcctacttcatccatcgttat
cacaagagcacccccaaaccacctatcgcttcagctgagatgactttccgcaggcctgcc
cagtcctatcctatcagctactctgccaacaatgttcgacgaggatctctggactccatg
gaaaaccaggtggccattgacaccttcaagatacctgaggatccaaagtgggaatttcca
cgaaaaaatctagtcctgggtaaaactctcggagagggagagtttgggaaggtcgtaaaa
gcaacagcattccggcttaaaggaaaggcaggatacactacagtagctgtaaaaatgttg
aaagaaaacgcctctcatggtgaacttcgtgaccttttgtccgaattcacgttgcttaag
caggtcaaccatccacatgtaataaaaatgtacggagcgtgtagccaggatggtcccctg
tatctgattgttgaatatgccaagtacggatcactgcgaaacttcctgagagagagccgt
aaagtggggcccagctatatgggtggcgatgcaaaccgaaactccagctacctcgagaat
ccagatgaaagagctctgaccatgggagacctcatctcgttcgcctggcagatctccaga
ggaatgcaatacctggctgaaatgaagcttgtgcatagagatcttgcggcaaggaatgta
ctcgtagcagagggcaggaagatgaagatatcagactttggtttgtctcgggatgtctat
gaggaagattcttatgtgaagaggagcaagggtcgtattcctgtcaaatggatggctatt
gagtctttgtttgaccatatatataccacacaaagcgatgtctggtctttcggtgtgctg
ttatgggaaattgtgaccctgggtgggaacccgtacccaggcattgcacctgagcggctc
tttaaccttcttaagactggctacaggatggaaaaacctgagaactgcactgaagaaatg
tatagtctgatgcttcgctgctggaagcaagaaccagataagagaccgaccttcagtgag
atcagcaaagagctggagaagatgatggtgaaaagcagagactatctggatctggcagct
tctactcctgcagacgccctgctatatgacgatactctgtccgaagaggacactcctcta
gtggactgtaataacacccctctccctcgaaccctcccttccacttggattgaaaacaag
ctctatggcatgtcatacccgaactggcctgagaagagcccggtactactcaacagactt
gatgcaactaatccagaatttacaagatatgccaatgatagtgtttatgcaaactggatg
gctttgccttctcctgcaaaagttatggacaagcttgatagttaa

DBGET integrated database retrieval system