KEGG   Ictalurus punctatus (channel catfish): 108263365Help
Entry
108263365         CDS       T04658                                 

Gene name
hk1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00010  Glycolysis / Gluconeogenesis
ipu00051  Fructose and mannose metabolism
ipu00052  Galactose metabolism
ipu00500  Starch and sucrose metabolism
ipu00520  Amino sugar and nucleotide sugar metabolism
ipu00524  Neomycin, kanamycin and gentamicin biosynthesis
ipu01100  Metabolic pathways
ipu01200  Carbon metabolism
ipu04910  Insulin signaling pathway
Module
ipu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ipu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ipu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108263365 (hk1)
   00051 Fructose and mannose metabolism
    108263365 (hk1)
   00052 Galactose metabolism
    108263365 (hk1)
   00500 Starch and sucrose metabolism
    108263365 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    108263365 (hk1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108263365 (hk1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    108263365 (hk1)
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108263365 (hk1)
Membrane trafficking [BR:ipu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    108263365 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 108263365
NCBI-ProteinID: XP_017319567
UniProt: A0A2D0QMD9
LinkDB All DBs
Position
3
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRLSDETLRDIMSRFRMELVKGLSRDTNATAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYETPEDIMH
GSGTRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCAQTKLDEAVLLTWTKRFKASGV
EGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGMLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGMLFEGRITPELLTKGKIETKHVSAIEKSKEGLTKAKEILTRLG
VEPSADDCIAVQHVCAIISFRSANLVAATLCAILTRLKDNKNVPRLRTTVAIDGSLYKMH
PQYSRRLHKTVRRLIPECDVRFLLSESGSGKGAALVTAWAYRLADQTRQIAETLAEFRLS
KEQLLEVKKRMHTEIQNGLSKKSQGTATVKLLPTYVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGMKNARLPLGF
TFSFPCRQTSLDAGILVNWTKGFKATDCEGEDVVNLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIAGTGSNACYMEEMRNIETVDGDEGRMCVNMEWGAFGDNGCLDD
IRTQYDRNVDDLSLNPGKQRYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRTILQHLGLDSTCDDSIIVKEVCGAVSRRAAQICGAGMAA
VVDKIRENRRLDRLDITVGVDGTLYKLHPHFSRIMHQTVNELAPKCNVTFLLSEDGSGKG
AALITAVGCRLRQQEQKN
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgatagccgcacagcttctggcctactacttcactgagctgaaggatgatcaggtcaaa
aagattgataagtacctgtactccatgcgcctctctgatgagacactgcgagacatcatg
tcccgtttccgtatggagctggtgaaagggctgagccgtgacaccaacgcaacagccact
gtcaagatgctgcccaccttcgtcaggtccatccctgatggatcagagaagggggatttc
attgctctggatctgggaggctctaatttccgaatcctgagagtgaaagtttctcatgaa
aagaagcaaacagtgcagatggagagtcagatctatgagactccagaagacatcatgcat
ggcagtggaacacggctatttgaccatgttgctgaatgtctgggggactttatggagaag
caaaagatcaaagataagaaacttccagtgggattcaccttctctttcccttgtgctcaa
actaaactggatgaggctgttttgctgacctggacgaaacgtttcaaagccagtggagtg
gaggggatggatgtggtgaagcttctgaacaaagctattaaaaagcgaggggactatgaa
gctgatatcatggcggtggtcaatgacactgtgggaaccatgatgacctgtggctttgat
gaccagcgctgtgaagttgggattatcatcggtaccggcactaacgcatgctacatggag
gagttgagacatattgacctggtggagggagacgagggcaggatgtgcatcaacacagag
tggggagctttcggagacgatggcatgctggaggacattcgcactgaatttgatcgagaa
attgaccgtgggtctctcaaccctggcaaacaattgtttgagaagatggtgagtggaatg
tacatgggggagctggtgcggctcatcctagtgaagatggccaaagaggggatgctgttt
gaaggccgcatcactccagagctactgactaaaggaaaaattgaaacaaagcatgtttct
gctattgagaagagtaaagagggattgaccaaagccaaggaaattttaacccgtttggga
gtggagccatcagcggatgactgcatcgctgtgcagcacgtgtgtgctatcatctccttc
cgctcagccaatcttgtcgctgctacactgtgtgctatccttactcgcctgaaagacaac
aagaatgtccctcgtctccgcactaccgtggccatcgatggctcactctacaagatgcac
ccacagtattcccgtcggctccataagactgtgcgacgtctgatacctgagtgtgatgtt
cgcttcctgctttcggagagtggaagtggcaaaggtgccgccttggtaacagcctgggcc
tatagactggctgatcagacacgtcagattgccgagacactggcggagttccgcctcagc
aaagagcagcttttagaggtgaagaaaaggatgcacacagagatccagaatggcttgagc
aaaaagagccagggcacagctacagtgaagctgctgcccacttacgtgcgcagcacccca
gatggcacagaaaatggagacttcttggctttggaccttggaggcacaaactttagggtg
ctcttagtgaagattcgcagtggtaagagacggactgtggagatgcataacaaaatctat
gccattcctatcgaggtgatgcagggaacaggagaagagctttttgatcacatcgtcacc
tgcatatcggacttcctggattacatgggaatgaagaacgcaaggcttcctttgggcttc
actttctctttcccctgtagacaaaccagccttgatgctggcatcctggtaaactggacg
aagggctttaaggccacagactgtgaaggagaggatgtcgtcaatctcctaagagaaggg
attaaaaggagggaggaatttgacttggatgtcgtggcagtggttaatgatacagtggga
accatgatgacttgtgcttatgaggaaccaacatgtgaggttggccttattgcaggaacg
ggcagtaacgcctgttacatggaagaaatgaggaacatcgagacagtggatggagatgag
ggcaggatgtgtgtgaacatggagtggggtgcatttggggacaacggctgcctggacgat
atcaggacccagtatgaccgaaacgtggatgatctctccctcaaccctggcaagcagagg
tatgagaagatgtgcagtgggatgtacctgggtgagattgtgcgaaatatcctcattgac
ttgacaaagcgtggcttcctcttcaggggtcagatctctgagactctcaagactaggggc
atctttgaaaccaaattcctgtcccagattgagagtgaccggttggcgctactgcaagtc
cgaactattctgcagcacttgggtctggacagcacgtgcgacgacagtattatagttaag
gaagtgtgtggtgcagtgtcacgtcgagccgcacagatctgcggtgcgggaatggctgct
gtggtggacaaaatccgagagaatcgaagactagatcgtctggacatcactgtgggggtg
gatggcacgctctacaaactccatccgcatttctcccggataatgcaccagaccgtgaac
gaactcgcacccaagtgcaatgtgactttcctgctctctgaagacgggagcggaaaaggt
gctgctctgatcaccgctgtcggatgccgcctacgtcagcaagaacaaaagaactga

DBGET integrated database retrieval system