KEGG   Ictalurus punctatus (channel catfish): 108263647Help
Entry
108263647         CDS       T04658                                 

Gene name
gsto1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00480  Glutathione metabolism
ipu00980  Metabolism of xenobiotics by cytochrome P450
ipu00982  Drug metabolism - cytochrome P450
ipu00983  Drug metabolism - other enzymes
ipu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108263647 (gsto1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108263647 (gsto1)
   00982 Drug metabolism - cytochrome P450
    108263647 (gsto1)
   00983 Drug metabolism - other enzymes
    108263647 (gsto1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ipu02000]
    108263647 (gsto1)
Enzymes [BR:ipu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108263647 (gsto1)
Transporters [BR:ipu02000]
 Other Transporters
  Pores ion channels [TC:1]
   108263647 (gsto1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin Nmad2
Motif
Other DBs
NCBI-GeneID: 108263647
NCBI-ProteinID: XP_017320168
UniProt: A0A2D0QNV9
LinkDB All DBs
Position
3
AA seq 240 aa AA seqDB search
MASSQKCRGKGSCAPGAVPKGQIRIYSMRFCPYAQRTRLVLNAKGIESETVNINLKEKPE
WYLEKNPLGLVPTLETPGGQVVYESAITCEYLDEVYPEKKLFPSDPFAKAQQKMLLEDYS
KIVPLFYKIPMTRIKGEDVSALEAELREKLSKLNKVLVDKKYKYFGGDTLTMIDYLIWPW
FERVEAWQLKHCLDGTPELNNWILRMREDPAVKAVMFSTDAHKAFFASFMEGKPNYDYGL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcccagaaatgccgtggaaaaggaagctgtgctcctggggctgtacccaaa
ggccagatacgaatctacagtatgagattctgcccatatgcccaaagaaccagactggtg
ctcaatgcaaagggtatagagtctgaaactgtcaacatcaatttgaaagagaagcccgag
tggtatctggagaagaaccctcttggcctagtgcctacactggagactcccggtggtcag
gtggtctatgaatcagcaattacatgtgaatacctggatgaggtataccctgagaaaaaa
ctgtttccctctgacccctttgcaaaagcccagcagaagatgttgttggaggattactca
aagatcgttcctctgttctacaaaattcccatgaccagaataaaaggtgaggatgtgtca
gcactagaagcagagttgagggaaaagctctccaaactgaacaaggttcttgttgataag
aaatacaaatactttggaggtgatacactcactatgattgactacctgatctggccgtgg
tttgagagggtggaggcctggcaactcaaacactgtctggatggcactcctgagctgaac
aactggattttacgtatgcgagaggatccagcagtgaaggcagtcatgttcagtacagat
gcccacaaagccttttttgcctcattcatggagggaaagcccaattatgactatggctta
taa

DBGET integrated database retrieval system