KEGG   Ictalurus punctatus (channel catfish): 108264484Help
Entry
108264484         CDS       T04658                                 

Gene name
mapk6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ipu01001]
    108264484 (mapk6)
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108264484 (mapk6)
Protein kinases [BR:ipu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108264484 (mapk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Ole-e-6
Motif
Other DBs
NCBI-GeneID: 108264484
NCBI-ProteinID: XP_017321555
UniProt: A0A2D0QUZ3
LinkDB All DBs
Position
4
AA seq 680 aa AA seqDB search
MAEKFESLMNIHGFDLGPRYTDLKPLGYGGNGLVFSAVDRDCDKRVAVKKIVLTDAQSVK
HALREIKIIRRLDHDNIVRVFETLGPSGRRLSEDASSLTEVNSVYIVQEYVETDLCTVLD
QGPLSEEHARLFVYQLLRGLKYIHSANVLHRDLKPSNLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVIHEEDRQELQSVIPVFIKNDMSLPHTPLTELLPGVSAEALDFLEKILTFN
PMDRLTAEEALAHPYMSVYSFPLDEPVSSHPFHIEDEVDDILLMDESHSHVYNWDRYQES
QLSEPEWPLQSAAEVDEVQRDPRAMSDDIDDEEAQLDPRKYADAESEKFLDEQPFDQRRD
EGVHHENKYCELECGHTCNYKAASQSYLDNLIWRDSEVNHYYEPKLIIDLSNWKEQQSKE
RADRKSKSKCEKNGLVKAQLDKEKHHQQHHQHHQGFDFDSFIAGTIRLSLQPESRDIGLL
NELNSSVSQLSKSASQEKDEKCQVNLAQQCPWESSGNESCLIDEACWDEQKDGGGYGGGY
TSYLDRLFSKKEEENPSVCSPPSDASLDAEPPREEAPPRLNGEIVLESLGFDAKRSLQAH
VRCSPQSAHKTYSSILKHLN
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaaattcgagagcctgatgaacatccacgggttcgacctgggcccgcggtac
acagacctgaagccgctagggtacggcgggaacggcctggtgttctcggcggtggaccgc
gactgcgacaagcgcgtcgcagtgaagaagatcgtcctgacggacgcgcagagcgtcaag
cacgcactgcgagagatcaaaatcatccgccgcctcgaccacgacaacatcgtgcgcgtg
ttcgagacgctggggccgagcggccggcgcctgagcgaggacgccagctctctgaccgag
gtgaactctgtgtacatcgtgcaggagtacgtggagacagacctgtgcaccgtgctggat
cagggcccgctctcggaggaacacgcccgcctgttcgtctaccagctgctgcgtggactc
aagtacatccactcggccaacgtcctgcacagagacctcaaaccctccaacctgttcgtc
aacaccgaggacctggtgctcaagatcggagacttcggcctggcgcgcatcatggacccg
cactactcgcacaagggtcacctgtctgaaggtctggtcacaaagtggtaccgttcccct
cgcctccttctctcccctaataactacactaaagccatcgatatgtgggcggccggctgc
atcttcgcagagatgctcacaggaaaaacactcttcgcaggtgctcatgagctggagcag
atgcagttgatcctggagtcgatccctgtgatccacgaggaggacagacaggagctgcag
agcgtcatcccggtgtttattaaaaacgacatgtctttaccgcacactccgctgactgaa
ctgctgcccggggtcagcgctgaggctctggacttcctggagaagatcttgacctttaac
cccatggaccggctgactgcagaagaggcactggctcacccctacatgagtgtgtactcg
ttccctctggacgagccggtgtcctctcaccccttccacatcgaggacgaggtagacgac
atcctgctcatggacgagagccacagccacgtctataactgggacaggtaccaggagagt
cagctgtccgagccggagtggcctctgcagagcgcggcggaggtggacgaggtgcagcgc
gacccgcgcgccatgtccgacgacatcgacgacgaggaggcgcagctggacccgcgcaag
tacgccgatgccgagagcgagaagttcctggacgagcagcctttcgaccagcggcgtgac
gagggcgtccaccacgagaacaagtactgcgagctggagtgcgggcacacctgcaactac
aaggcggcgtcccagtcctacctggacaacctgatctggagggatagcgaggtgaaccac
tactacgagcccaagctgatcatcgacctctccaactggaaagagcagcagagcaaagag
cgagcggaccgcaagagcaagagcaagtgcgagaagaacggcctggtgaaggctcagctg
gacaaggagaagcaccaccaacaacaccatcaacaccatcagggcttcgacttcgactcc
ttcatcgccggcaccatccgactcagcctgcagcccgagagccgcgacatcggcctgctc
aacgagctcaacagctccgtgtctcagctcagcaagtcggccagccaggagaaggacgag
aagtgtcaggtgaacctggctcagcagtgcccgtgggagagcagcgggaacgagagctgc
ctgatcgacgaggcgtgctgggacgagcagaaagatggcggaggatacggaggaggctac
accagctacctcgatcgcctcttcagcaaaaaagaggaggagaacccctccgtctgctct
cctccttccgacgcttccctggacgccgagcctccgcgagaagaagccccgccccgtctc
aacggcgagatcgtcctcgagtctctggggttcgacgctaaaagatccctgcaggcccac
gtcaggtgttctcctcagagcgcccacaagacctacagcagcatcctcaaacacctgaat
taa

DBGET integrated database retrieval system