KEGG   Ictalurus punctatus (channel catfish): 108264758Help
Entry
108264758         CDS       T04658                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00052  Galactose metabolism
ipu00500  Starch and sucrose metabolism
ipu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108264758
   00500 Starch and sucrose metabolism
    108264758
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     108264758
    3.2.1.20  alpha-glucosidase
     108264758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 108264758
NCBI-ProteinID: XP_017322094
UniProt: A0A2D0QX67
LinkDB All DBs
Position
4
AA seq 1809 aa AA seqDB search
MGKRKFSGLEIALMVMFVMIGIVAIALIALLATRINETKTFIAQCPNIPLAERVDCFPDA
GASQQSCQKRGCCWGPHDQTNVPWCFFSSNHGYTVVSQSQTSSTKLEARLKRQDAPSLFG
SDILELSFVAEMQTENRLRFKITDPNEARFEVPHEHIQSLSSSQNGPLKYEFELLKNPFG
VRVRRASNKKVLFDTSIGPLIFANQYLQLSAKLSSDNIYGLGEHVHKKFRHDIDWKTWPI
FTRDAFPNGGTHNLYGHYPFFMCLEDESGKSFGVFLMNSNAMEVTLQPAPAVTYRTIGGV
LDFYILLGDTPEAIVQEFTQLVGRPTIPPYWALGFQLSRWDYGSLEEVKKTVERNRAIGL
PYDVQYTDIDYMEDKKDFTYDMVKFKDLPQFADYMHAEGQKYILIFDPAIATSKRINGAY
ESYDRGSQAEAWITEADGKTPILGEVWPGQTVFPDYTKQSCIRWWVDEIIQFHKQVNHDA
IWIDMNEVASFVKGSSKGCADNSLNYPPFTPNILDNLMYSKTLCMDAKQSWGNHYDVHSL
YGYSMVLATEEAVRQVFGSNRSFILTRSSFPGVGKYSGHWLGDNAANWNDIKWAIPGMLE
FNLFGVPYIGADICGFFDDTTEELCTRWMQVGAFYPFSRNHNAQYYKPQDPAAFGADSVL
VKSSKHYLSIRYTLLPYLYTLFYRAYISGDTVVRPVMHEFYSDPATWTVDLQFLWGAHLL
ITPVLDAGVDKVRAYIPDAVWYNYETEEKIKERKQQVEIYLPLDKMGVHIRGGAILPIQR
PAVTTVDSRRSPMGLIIALDDNNQASGELFWDDGHSRDTVSSGVYILYQFSVVQGLLTMK
ALHSGYADPNNLVFENVTVLGLSSPPTTVTIEDGNIVTALPESNIQYDSVKKVLHLRNLQ
LQLGKDYKLAWNSIVDDLQRFDCYPGEMATEESCIKRGCIWGYTHLNGVPWCYFPSDYGY
IAETSQEMPYGWSFNIRRNDKYPAPRILSRDINILRVEIKYLTGHSLQFKIFDPANKRYE
VPVPLHLPSKPDVPEEKRMYTVNFTKQPFGIQVIRKSTGTIIWNSSVPGFTFSDMFIQIS
TLLPSQYIFGFGETEHTSFRHDMNWHTWGMFSKDQPPGYKLNSYGVHPFYMGLEPSSHAH
GVLLLNSNAMDVTVQPTPALTYRTIGGILDFYMFMGPTPELVVEEYTEMIGRPVLPAYWS
LGFQLCRYGYANDSEIAELYADMLSASIPYDVQYADIDYMERQLDFVLDKDFVNLPQLVK
KMRGEGMRFIFILDPAISGNETVYPAFERGVEKDVFIKWPAELGDGIVWGKVWPDYPNVT
VDDSLDWETQVEKFRSYAAFPDFFRNRTAEWWQREISDFYNRMTFDGLWIDMNEPASFVD
GTVGGNCLGPAIFDDPPYMPPLESKERGLTHKTLCMNSQQFLPDGTPVKHYDVHNLYGWS
HTKPTYDALLNVTGKRGIVVSRSTYPSSGQWAGHWLGDNTAAWDQLYKSIIGMMEFSLFG
IPYTGADICGFFNQAEYEMCLRWMQLGAFYPYSRNHNGKGNPRQDPVAWDAAFAIASRDV
LNIRYTLLPYLYTLMFEAHTKGSSVVRPMLHEFVNDKVTWDIYKQFLWGPALLISPALDK
GVTEVNGYIPNARWYDYHTAKLVNVRGKFLTMSTPLNHTNIHVRGGFILPWQKPENNTKY
SRKNPLSLIAALDDDGTATGSLFWDDGEGIDTYQKNEYLLTYFTVFKNTLSNLVMHHSLA
PTDQLTLGQVKVWGAGSLAITKVTMKTAETEMPLTTFSHDPVTEELFIDATSKSHAIGEQ
FSITWNTGI
NT seq 5430 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaggaaattctctgggttggagatagccctgatggtgatgtttgtcatgatc
gggatagttgccatagcacttattgccctgcttgccacaagaataaatgagacaaagaca
tttatagcacagtgtccaaatattcccctggctgaaagagtggattgttttccagacgca
ggtgcctcgcagcaaagctgtcagaagcgtggctgctgctggggcccacatgatcaaaca
aacgtgccttggtgtttcttctctagtaatcatggctacactgtggtcagtcaaagccag
acaagtagcacaaaattggaggccagactgaaaagacaggatgcaccatctctgtttggc
tctgacattcttgagctatcctttgtagcagaaatgcagacagaaaatcgccttcgattt
aagatcactgatccaaatgaagcccggtttgaagttcctcatgaacacatccagtctctg
tccagctctcagaatggaccactgaagtatgagtttgagcttctcaagaatccttttgga
gtgagagttcgcagagcatccaataaaaaagttctctttgataccagtattggaccgctg
atttttgctaaccagtacctacagctctctgctaaactctcctcggataacatttatgga
ctcggtgaacacgttcacaagaaattccgccatgatattgactggaagacatggcctata
tttacacgagatgcctttcccaatggtggtactcacaacctgtatggtcactaccctttc
ttcatgtgcctggaggatgaaagtggaaaatcctttggtgttttcctaatgaacagcaat
gctatggaggtgactcttcagccagcacctgctgtgacctacagaacaattggaggagtt
ctggacttttatatcctgcttggagacacaccagaggctattgtacaggagttcacacag
ctggtcggcaggccaactattcctccatattgggctttaggtttccagctctcacgctgg
gactatggcagcttggaagaagtcaagaaaactgtggagagaaatcgagcaattggcctt
ccttatgatgtgcagtacacagatatagactacatggaggacaaaaaggacttcacttac
gacatggtgaagttcaaagacctgccacaatttgctgactacatgcatgcagaagggcaa
aaatatattctcatattcgatcccgccatagccacaagcaagagaatcaatggcgcatac
gagtcatatgacagaggatcacaagctgaggcatggatcactgaggcagatggaaagact
ccaatactgggagaggtttggcctggacagaccgtgtttcctgactacaccaagcaatcc
tgcatcaggtggtgggtggatgaaatcatccaattccataagcaagtgaatcatgatgca
atctggattgacatgaacgaagtggccagctttgtgaaaggctccagtaaaggatgtgct
gataattcactgaattatccaccgttcactccaaacatccttgataatttgatgtacagt
aagactttgtgtatggatgcaaagcagtcctggggaaatcactatgatgttcacagtctt
tatggatattccatggtgctggcaacagaagaggctgtgagacaagtctttggcagcaat
cgttcattcattctcactcgttcctctttccctggagtaggaaagtattcaggccactgg
ctgggtgataatgctgccaactggaatgatattaaatgggcaatacccggcatgctggag
tttaacctatttggagtgccttatatcggtgcagatatctgtggcttttttgacgacaca
accgaggagctgtgcacacgctggatgcaagtgggagccttttatccatttagtcgtaat
cacaatgctcagtactacaaacctcaggatcctgcagctttcggcgctgactccgtgctg
gtgaaaagttccaaacactacctgagcatccgctacacactcctgccatacctttacaca
ctcttctatagagcttacatcagtggggacactgtggtgagacccgtcatgcatgaattc
tactcagaccctgcaacatggacagtggatcttcaatttttatggggcgcacatttgctt
atcacaccagtactggatgctggtgtggacaaagttagagcatacattcctgatgctgta
tggtataactacgagacagaagagaaaatcaaggagcggaaacagcaagttgaaatctac
ctgccactagataagatgggtgttcacatcaggggtggagccattctgccaatccagaga
cctgcagtcactactgtggatagtcggcgttctcctatgggcctaatcattgcgcttgat
gacaacaaccaggcatcaggcgagctgttctgggatgatggacattctcgagatacggtt
tcatctggggtgtacatcctttaccagttctctgttgttcaaggactgctgacaatgaag
gcactccacagtggatacgctgatccaaacaatctggtgtttgagaatgtcactgtttta
ggactgagtagcccccccacaactgtgaccatcgaagatggcaacatagtcactgctttg
ccagagtccaacattcaatatgactcagtgaagaaggtgctacatctgagaaatctccaa
ctgcagctggggaaagattacaaactcgcctggaattcaatcgttgacgatttacagcgg
tttgactgctatccaggggaaatggccactgaagagtcctgcataaaaagaggctgcatc
tgggggtacacacatctaaatggtgtgccgtggtgttatttcccctcggattatggctac
attgctgagacttcacaggaaatgccatacggatggagctttaatatcaggcggaatgat
aaataccctgctccacgtattttatctagagacatcaacatactacgggtggaaatcaaa
tatctgactggacactccctacagtttaagatctttgatccagctaataagcgttatgaa
gttcctgttcctcttcatttaccatccaaaccagatgtaccggaggaaaagaggatgtac
acagtaaatttcacaaagcaaccatttggtattcaggtgatcaggaaaagcacaggaacc
atcatttggaattcgtctgttcctggctttactttctctgacatgttcatacaaatttca
actctacttccttcacaatatatctttggctttggggagacggaacatacaagctttaga
cacgacatgaactggcacacatggggcatgttcagtaaggaccaaccaccagggtataag
ttgaactcttatggtgtgcatcccttctacatgggcctggagccaagctctcatgctcat
ggagtcctgctgctcaacagcaatgccatggatgtgacagttcagccaacgcctgctctc
acttaccgcaccattggtgggatccttgacttctacatgtttatgggtcccactccagaa
ctggtggtagaggaatacactgagatgattggccgtccagttctcccagcttattggtct
ctaggattccagctttgtcgctatggttatgctaatgattcagaaattgctgagctttat
gctgatatgttgagtgccagtattccttatgatgtccagtatgcagatattgactacatg
gagaggcagctggactttgtgctcgataaggacttcgtcaaccttcctcagctggtcaaa
aaaatgaggggggagggcatgcgtttcatcttcatcctggatcctgcaatttcaggcaat
gagactgtttatcctgccttcgagcgcggtgttgagaaggacgtgttcattaaatggcca
gctgagttgggtgacggcatcgtctggggaaaagtatggcctgactatccaaacgttaca
gttgatgactctctggattgggagacacaagtagagaaattcaggtcgtatgcagcattc
ccagactttttccggaaccgtacagcagagtggtggcagagagaaatcagtgacttctat
aatagaatgacttttgatggcctgtggattgacatgaacgagccagctagttttgtcgat
ggcactgttggaggaaattgtctaggcccagcaatctttgatgatccaccatacatgcca
ccactggagtctaaagaacgagggctgactcacaaaaccctctgtatgaacagtcagcag
tttcttcccgatggcactccggttaaacactatgatgtgcacaacctgtatggctggtct
cacaccaaaccaacttatgatgccttgctgaacgtaacagggaagagaggaattgtggtg
agtcgctcaacatacccgagcagtgggcaatgggcaggacactggttgggagataataca
gctgcctgggatcaactctacaagtctataatagggatgatggagttcagtttgtttgga
atcccttatactggagctgatatttgtgggttctttaaccaagccgagtatgagatgtgc
cttcgctggatgcagctgggagcattttacccatattccagaaatcataatggcaaggga
aatccgagacaagaccccgtggcatgggatgctgcatttgctattgcatctcgagacgtc
ttgaacatccgttacacacttctcccctacctgtacacactcatgtttgaggctcacact
aaaggcagtagtgtggtccggcctatgctccatgaatttgtgaatgataaagtgacatgg
gacatttataaacagttcctgtggggtccagcattgctcatcagtcctgctctggataag
ggagtaactgaggttaatggctacatcccaaatgcacgctggtatgattaccacacggca
aagttggtgaatgtgagaggcaagtttcttaccatgtccactccactcaatcacaccaac
atacatgtgagaggaggattcatactaccatggcagaaaccagagaacaacacaaaatac
agtcgcaagaatcctctcagtctgattgctgctcttgatgatgatggaacagcaacaggt
tctctgttctgggatgatggagagggaattgacacatatcagaagaatgaatatctcctg
acatacttcactgtgtttaagaacactctctcaaacttagttatgcatcatagtctagct
ccaactgatcagctcacacttggccaagtgaaagtttggggtgcgggaagtctcgccatc
actaaggtgaccatgaagacagctgaaactgaaatgccgctgaccacattttcccatgat
ccagtcacagaggagctgttcatcgacgcaacaagcaaatcacatgcaataggagaacaa
ttctctatcacttggaacacaggaatatga

DBGET integrated database retrieval system