KEGG   Ictalurus punctatus (channel catfish): 108265385Help
Entry
108265385         CDS       T04658                                 

Definition
(RefSeq) trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108265385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ipu01002]
    108265385
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ipu04147]
    108265385
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     108265385
Peptidases [BR:ipu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108265385
Exosome [BR:ipu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108265385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 108265385
NCBI-ProteinID: XP_017323142
UniProt: A0A2D0QXK6
LinkDB All DBs
Position
1
AA seq 246 aa AA seqDB search
MKWIIVLSLFAVAFTAPIDEEDKIVGGYECRKNGVRYQVSLNAGYHFCGGSLISNLWVLS
AAHCYKSRIEVRLGEHNIDVNEGTEQFISSAAVIRHSSYNSNTLNNDIMLIKLSRAATLN
SYVSTVALPSGCASAGTVCLISGWGNTLSSGTNYPSNLRCLDAPILSDTTCKNSYPGEIT
SNMFCAGFIEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKNKPGVYTKVCNYSAWIR
DTMSRN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggatcattgtactctctctgtttgcagtggcattcactgcccctattgatgaa
gaggataagattgtcggagggtacgagtgcagaaagaatggcgtgcgctatcaggtgtct
ctgaatgctggataccacttttgtggaggctctctgattagtaatctgtgggtcctgtca
gctgctcactgttataaatcgcgtattgaggtgcgtttgggtgagcacaacattgatgtc
aacgaaggaacagagcagttcattagctcggcagcggtcatcaggcactccagttacaac
agcaacactctcaacaatgatatcatgctcatcaagcttagccgggctgccaccctgaat
agctatgtctcaactgtagctttgccctccggctgcgcttctgctggaacagtgtgcctc
atctccggatggggaaataccctcagcagtggcacaaactacccttccaacctgaggtgc
ttggatgccccaatcctgagtgacaccacttgcaaaaattcttatcctggagagatcact
tccaacatgttctgcgctggcttcattgagggaggcaaagattcttgccagggagattct
ggtggcccagtcgtgtgtaatggtcagctgcagggtatcgtgtcctggggttatggctgc
gctctcaagaataagcctggtgtctacacgaaagtctgcaactactctgcctggatcagg
gacaccatgagccgcaattag

DBGET integrated database retrieval system