KEGG   Ictalurus punctatus (channel catfish): 108265547Help
Entry
108265547         CDS       T04658                                 

Gene name
b3galt4
Definition
(RefSeq) beta-1,3-galactosyltransferase 4
  KO
K00715  ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00604  Glycosphingolipid biosynthesis - ganglio series
ipu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    108265547 (b3galt4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ipu01003]
    108265547 (b3galt4)
Enzymes [BR:ipu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     108265547 (b3galt4)
Glycosyltransferases [BR:ipu01003]
 Glycan extension
  Glycolipid
   108265547 (b3galt4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T Fringe
Motif
Other DBs
NCBI-GeneID: 108265547
NCBI-ProteinID: XP_017323490
UniProt: A0A2D0R132
LinkDB All DBs
Position
5
AA seq 366 aa AA seqDB search
MVIRGLWVCKIRVVKHFGLAQVLCLLVFTCLFAGLFFDYIESWVTSLRMSGVGGAHGGIL
LQSVPPTRPEEYLLMPSSLVCQRAKPYLITLVTSTPANAKARQAIRDTWGGEVQVRGYRV
MTLFMVGQVSDPVLTKQLMEEAREHGDLVQGRFLDSYANLTLKTLSMLAWARRFCPEARF
LAKVDDDVMFNPSALLQYINLKWRTPERELEELYLGRVHLRVAPDHNPASKHYFSKDVFS
GTVYPDYCSGTAYVLSRPAVLKLSLAAAATPLPKPLPPEDVFVGLCAHTAGISPTHCPLF
SGGPPVPYARCCYQAMVSVHHTTPEEMLHYWADMHSNAPCTWVGVRTSLGICKLKAYLGH
LLWPRL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggtgatccgtggtttgtgggtttgtaaaatccgtgtggtgaagcactttgggctggca
caagtcctgtgcctactggtctttacttgcctttttgcaggcctcttcttcgactacatt
gagtcatgggttacttctctaagaatgagtggagtcgggggtgcccacggagggattctt
cttcagagcgtgcctcctacacgtccagaagaatacctccttatgccaagttcgcttgtt
tgccagcgcgcaaagccctacctcatcaccctggtgacctcgacccctgctaacgcgaaa
gctcgtcaggcaatccgtgacacctggggtggtgaagtgcaagtccgaggttatcgggtc
atgactttgttcatggtggggcaggtatcggatcccgttttgaccaaacaactgatggag
gaagcacgggaacacggagacctagtccaaggtcgctttttggactcctatgctaatctg
accttaaagaccttgtccatgttagcttgggcccggcgcttctgccctgaagctcggttc
ctagccaaagtggatgacgatgtgatgttcaaccccagtgcgttgcttcagtacatcaac
ctcaagtggaggacaccagagagggagctcgaagaactctaccttggtcgggttcacctt
agggttgcaccggaccataatccagccagcaagcactatttttctaaagatgttttctca
gggacagtctaccctgattactgcagcggaactgcatacgtgctttcccgtcccgctgtc
ctaaagctttctctggcagctgctgccacaccgttgcccaagcccctgcctcctgaagat
gtgtttgtaggcttgtgtgcccacacagctggcatctctcccacccactgcccactcttc
tccggaggaccacccgtgccatatgcacgctgctgctaccaggccatggtgtccgtccat
cacactacacctgaggaaatgctccactactgggcagacatgcattccaatgctccctgc
acctgggtgggagtccggacttcacttggcatttgtaaattgaaagcgtatctaggacac
ttgttatggcctagattataa

DBGET integrated database retrieval system