KEGG   Ictalurus punctatus (channel catfish): 108265558Help
Entry
108265558         CDS       T04658                                 

Gene name
OGDH
Definition
(RefSeq) 2-oxoglutarate dehydrogenase, mitochondrial
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00020  Citrate cycle (TCA cycle)
ipu00310  Lysine degradation
ipu00380  Tryptophan metabolism
ipu01100  Metabolic pathways
ipu01200  Carbon metabolism
Module
ipu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ipu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ipu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:ipu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108265558 (OGDH)
  Amino acid metabolism
   00310 Lysine degradation
    108265558 (OGDH)
   00380 Tryptophan metabolism
    108265558 (OGDH)
Enzymes [BR:ipu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     108265558 (OGDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 108265558
NCBI-ProteinID: XP_017323525
UniProt: W5UME1
LinkDB All DBs
Position
5
AA seq 1022 aa AA seqDB search
MHRLRTCAARLRPITASQTAKTPTQQRPTATFRTFQPIRRYTAPVAAEPFLNGTSSNYVE
EMYYAWLENPKSVHKSWDIFFRNANAGAPPGTAYQSPPPLGMGLAELTQAQSLVGAQPNV
EKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGIMDADLDSCVPTDIITSSDKLGFYGLEES
DLDKVFRLPTTTFIGGTESALPLREIIRRLEMSYCQHIGVEFMFINDLDQCQWIRQKFES
PGVMQFSLEEKRTLLARTVRSTRFEEFLQKKWSSEKRFGLEGSDSLIPALKTIIDKSSEC
GVENVVMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINR
VTDKNITLSLVANPSHLEAVNPVVQGKTKAEQFYCGDNGGNRVMSILLHGDAAFAGQGIV
YETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDP
EAVMYVCNVAAEWRATFHKDVVVDLVSYRRNGHNEMDEPMFTQPLMYKQIKKQKPVLLKY
AEKLIAEGVVTRQEYEEEIAKYDKICEEAYARSKDEKILHIKHWLDSPWPGFFTLDGQPK
SMTCPSTGLSEEELTHIGQVASSVPVEDFTIHGGLSRILKARGEMIRNRTVDWALGEYMA
FGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHMAPNQAPYTVCNSSL
SEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLP
HGMEGMGPEHSSARPERFLQMCNDDPDVFPKITDDFAVRQLYDCNWIVVNCSTPANFFHV
LRRQILQPFRKPLIVFTPKSLLRHPEAKSNFDLMLPGTHFLRMIPEEGLAAQDPAAVKRL
IFCTGKVFYELKRERKTRGQENTVAIARVEQLSPFPFDLVKAETEKYPNADLVWCQEEHK
NQGYYDYVKPRMRTTIDRSKPVWYAGREPAAAPATGSKNSHLLELKRFLDTAFNLDAFKD
HI
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcttaaggacttgtgcggcgcggcttcggccgatcacggcctcacagactgct
aagaccccgacacagcagaggcccacggccacattcaggacgtttcagccaatcaggcgc
tacaccgcgccggtggccgcagagccgtttctgaacggcacgagctcgaactatgtagag
gagatgtactacgcctggctggagaaccccaagagcgtgcacaagtcttgggacattttc
ttcaggaacgctaatgctggggctcccccgggcaccgcctaccagagtcctcctccgctg
ggcatgggcctggccgagctgactcaggcccagtctctggtcggtgctcagcccaacgtg
gagaagttggtggaggaccatctggctgtgcagtcgctcatcagagcttatcagatccgg
ggtcaccatgtcgctcagctggaccctctggggatcatggatgccgatctggactcgtgc
gtccccaccgacattattacgtcttcggataaactcggattctacggattggaggagtcg
gatctggacaaagtgttccgcctgcccaccactaccttcatcgggggcacagagagcgct
ctgcctctgcgggagatcatccgccgcctggagatgtcgtattgccagcacataggagtg
gagttcatgttcattaacgacctggaccagtgccaatggatccgtcagaagtttgagagt
cccggggtcatgcagttcagcctggaggagaaacgcacactgctggcccgcacggtccgc
tccaccaggtttgaagagttcctccagaagaagtggtcctcagagaaacgttttggcctg
gagggctccgacagcctcatccccgccctcaaaaccatcatcgacaaatccagcgagtgc
ggcgtggagaacgtcgtcatgggaatgccgcacagaggacgactgaatgtgctggccaac
gtgatcaggaaggagctggagcagatcttctgccagttcgactccaagctggaggctgca
gatgagggatcaggagacgtgaagtaccacttgggcatgtaccacaggaggataaaccgt
gtgacggacaagaacatcactctgtctctggtggccaacccatctcacctggaagccgtg
aacccggtggtgcagggcaaaaccaaggccgagcagttttactgcggagacaacgggggc
aaccgggtgatgtccattctgctgcacggtgatgccgcgttcgccggccagggcatcgtc
tacgagaccttccatctgagcgacctgccatcttacactacacacggcacagtgcacgtg
gtcgtcaacaaccagattggcttcaccactgatccccgcatggcccgctcctctccgtac
cccaccgatgtggcgcgcgtggtgaacgcgccgatcttccacgttaacgcggacgacccg
gaggccgtcatgtacgtgtgcaacgtcgccgctgaatggcgagccaccttccacaaagac
gtcgtggtcgacctggtgagttatcggcgtaacggccataacgagatggacgagcccatg
ttcacacagccgctgatgtacaagcagatcaagaagcagaagccggtgctgctgaaatac
gcggagaaactcatcgctgagggagtggtcacacgccaggagtatgaggaggagattgcc
aaatacgacaagatctgtgaggaggcttacgctcgctctaaggacgagaaaatcctccac
atcaagcactggctggattccccttggcctggttttttcacactggacggccagcccaaa
agcatgacctgtccttctacaggattgagtgaggaggagctgacgcacatcggtcaggtg
gcgtcatccgtacctgtggaagactttactattcacgggggtctgagtcggatcctgaag
gctcgaggtgagatgatccggaaccggacggtggactgggctctgggagagtacatggcc
ttcggttctcttctcaaagaggggatccacgtgcgtctcagcggccaggacgtggagaga
ggaaccttcagtcaccgtcaccacgtcctccacgatcagaatgtggataagaggacgtgt
atccccatgaaccacatggccccgaaccaggctccctacaccgtgtgcaacagctcgctg
tccgagtacggagtgctgggtttcgagttgggcttcgccatggccagtccgaacgctttg
gttctgtgggaggcccagtttggagacttccacaacacggcccagtgtataatcgaccag
tttatctgtcccggacaggccaagtgggtccgccagaacggcatagtcctgctgctgccg
cacggcatggagggcatgggtcccgagcactcgtcagctcgccccgagcgtttcctgcaa
atgtgcaacgacgatcctgacgttttccctaaaatcacggacgacttcgctgtgcgtcag
ctgtacgactgtaactggatcgtggtgaactgctccactcctgccaacttcttccacgtg
ctgaggaggcaaatcctgcagccgttcaggaagcctctcatcgttttcactcccaaatct
ctgctgcgccacccagaggccaagtccaactttgacctgatgctgcctggcacccatttc
ctgcgtatgatcccagaggaaggtcttgcagcccaggacccagctgcggtgaagcgtctg
atcttctgcacagggaaagttttctacgagctcaagcgcgaacgcaaaacccgtggccag
gagaacaccgtggccatcgcacgcgtcgagcagctctctccattccccttcgacctggtc
aaggccgagacggagaaataccccaacgctgacctggtgtggtgtcaggaggagcataag
aaccagggttactacgactacgtgaagcctcgcatgcgcaccaccatcgaccgctccaag
cccgtctggtatgctggtcgtgaacctgctgctgccccagccaccggcagcaagaactcc
cacctcctggagctgaagcgcttcctggacactgccttcaacctggacgccttcaaagat
cacatctaa

DBGET integrated database retrieval system