KEGG   Ictalurus punctatus (channel catfish): 108265881Help
Entry
108265881         CDS       T04658                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1-like
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ipu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    108265881
Enzymes [BR:ipu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108265881
Chromosome and associated proteins [BR:ipu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108265881
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108265881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 108265881
NCBI-ProteinID: XP_017324180
UniProt: A0A2D0R2Z9
LinkDB All DBs
Position
5
AA seq 419 aa AA seqDB search
MAENLKECKVACLATFDQLEVVCREEWVKCQELGVNKNNLCDYEVEYLCNYKRNFMTDGK
RQETQDLYLVKWKGYPESMNSWEPQQNLKCTDLLNQFWEDLMREMVRLKKRNVPKKLDAS
IVSNLVQRAKLRQTLKLWENHLNSLGSDKGRIYVENLVDMEGPPKNFTYITDYKVGDGIS
LNEVAVGCECTDCLNSPLEGCCAGASQHKFAYNDSGQVRIRPGLPIYECNRRCSCGPDCP
NRVVQRGIQYSLCIFRTDNGRGWGVRTMERIRKNTFVMEYVGEIITTEEAERRGHVYDKE
GATYLFDLDYVDDEYTVDAAHYGNISHFVNHSCDPNLQVYNVFIENLDERLPRIAFFATR
AIKQGEELTFDYNMRIDPVDAESTKMDSNFSLTGLPGSPKKRMRVECKCGVPTCRKYLF
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttgaaagagtgcaaagtagcatgtcttgctacttttgaccaactggaa
gtggtttgccgagaggaatgggtcaaatgtcaagaactgggcgttaacaagaacaacctg
tgtgactatgaagtggaatacctttgtaactacaaaagaaactttatgactgatgggaaa
agacaagagacacaggatctgtacttggtaaaatggaagggctatccggagtctatgaac
tcgtgggagccacagcagaacctgaagtgcactgatctgcttaaccagttctgggaggat
ttgatgcgtgagatggtgcggttaaagaagcgcaatgttcccaagaaactggatgcttcc
attgtatctaatcttgtgcagcgagcaaagcttaggcaaaccctcaaactctgggagaat
cacctgaacagcctaggctcagacaaaggtcgcatctatgtggaaaacctggtagacatg
gagggtcctccaaagaacttcacctacattaccgattataaggtgggtgatggtatttct
cttaatgaggtggctgttggctgtgagtgtacagactgcctgaatagtcctctggagggc
tgctgtgccggagcctcgcagcacaagtttgcctacaacgactctggacaagtgcgtatt
cggcctggactacctatctacgaatgcaacaggcggtgttcctgtgggcccgactgcccc
aacagggtggtgcagaggggcattcagtattcactgtgcatctttaggacagacaacggc
aggggctggggggtacggaccatggagcgcatccgcaagaacaccttcgtcatggagtat
gtaggagagatcatcactacagaagaagcagaaaggcgagggcatgtctacgataaagaa
ggcgccacctacctgtttgacctggattatgtggatgatgaatatacagtggatgcagct
cactatggcaacatttcccacttcgtcaatcacagttgtgatccaaatcttcaggtatat
aacgtctttatagaaaacttggacgagagacttccacggatagctttctttgccactcgt
gccattaaacaaggggaggagctcacctttgactacaacatgcggattgatccagtagat
gcagaaagcacaaagatggactctaatttcagtttgacgggacttccaggttctcctaag
aaacgcatgcgtgtagaatgtaaatgtggtgtgccaacatgtcgaaaatatctattttag

DBGET integrated database retrieval system