KEGG   Ictalurus punctatus (channel catfish): 108266193Help
Entry
108266193         CDS       T04658                                 

Gene name
tmprss3
Definition
(RefSeq) transmembrane protease, serine 3
  KO
K09634  transmembrane protease serine 3 [EC:3.4.21.-]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ipu01002]
    108266193 (tmprss3)
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     108266193 (tmprss3)
Peptidases [BR:ipu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108266193 (tmprss3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Ldl_recept_a SRCR DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 108266193
NCBI-ProteinID: XP_017324720
UniProt: A0A2D0R4J3
LinkDB All DBs
Position
6
AA seq 549 aa AA seqDB search
MADPEAEARAKLEDGVVEAPLTGGGESGVTHDQVAETKQMENAQLEVVSVGDQDLPASTN
SLEIHNVSISAENSANNPGSENAEQPDCQTETTNDVQAQCPSPGMPVTKVQPFLSGDEAD
DKTLRGRLFARRMELLIGVCALLTVTLVLGIGLGVGLSCRGKFRCSSSLCVSISAQCDGH
VDCEHGEDELSCVRVSGKSSVLQVLSGGVWSTVCSETWDSNLGLSACKQLGYSSYVESGS
LPLTSIEQDLQDNLVSINVSQPSHLHPIKIHNTTNLSKTECRSGKIITLRCLECGSRPQY
RARIVGGNLSREGQFPWQVSLQFQNEHLCGGSIIATQWILTAAHCVYGFAYPPVWTVLAG
LTEQPATRSNYLTVEKIIYHGRYRPKGLDYDIALLKLSQPLTFTGYIEPICLPNFGEEFE
DGKICWISGWGATEDGGEASVSLHSAKVPLISTKACSQPEVYQGYISPGMICAGYLEGGT
DSCQGDSGGPLACEDSSVWKLVGATSWGQGCAERNKPGVYTRITQALTWIHQQMEREETL
NPSPISSDN
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggctgacccagaggcggaggccagagccaagcttgaggatggagttgtagaggctcca
ctaacaggtggaggagagagtggagtcacacacgatcaggttgcagagacgaagcaaatg
gaaaatgctcaattagaggtggtgtctgttggagatcaggatcttccagcttccactaat
tcccttgagattcacaatgtcagcatctcagcagaaaacagcgccaataacccaggctct
gagaatgcagagcagccagactgtcagacagaaactaccaacgatgtccaagcacaatgt
ccaagtccaggaatgcctgtaactaaagtccaaccgtttctgtcgggtgatgaagcagat
gacaaaacgctcagaggtcgtttatttgcacggagaatggagcttttaattggtgtctgc
gcgttgctcactgtcacccttgtccttggcatcggtctgggagtgggcctgagctgtaga
gggaagttccggtgcagctcatcgctctgtgtcagcatctctgcgcagtgtgatggacac
gtggactgtgaacacggcgaggacgagctcagctgtgtgcgtgtgagtgggaagagttcg
gtgctgcaggtgttaagtggaggagtctggagcactgtgtgttcagaaacgtgggactct
aatctgggtttatctgcctgcaaacagctgggatactccagttatgtggagtctggttcc
ctccctctcacctcgattgaacaagaccttcaggataatctggtgtcgatcaacgtgagc
cagccgagtcacctgcatccaatcaagatccacaacacgaccaacctgagtaaaactgaa
tgcagatcagggaagatcataactttaaggtgcttggagtgtggctctcggccccagtac
agagcacgtatagtggggggtaacctgtctcgagaaggccagtttccttggcaggtgagt
cttcaattccagaatgagcacctgtgtggaggatctattatagcgacacagtggatatta
acagctgcacactgtgtgtatggctttgcatacccccctgtgtggacggtgctcgctgga
ctcacagaacaaccagccactaggtccaactatctcaccgtggagaaaattatttatcat
ggccgctacagacccaaaggcctggactatgatatcgccctgctgaaactgtctcagccg
ctcaccttcactggctacattgagcccatctgcctgccaaactttggagaggagtttgaa
gatgggaagatatgctggatctcaggatggggagccacagaggatggaggtgaagcgagt
gtgtctctgcattctgcaaaggtgccactgatctccaccaaagcctgcagtcagcctgaa
gtctatcagggctacatctcccccggcatgatctgtgcaggatacctagaaggaggaacc
gactcctgccagggggacagcggtggtcctctggcctgtgaggactcatctgtgtggaag
ctggtgggagcgacgagttggggtcagggctgcgccgagcgaaacaaacccggagtctat
acacgcatcacacaagctctcacctggattcatcagcagatggagagagaagaaacactg
aacccctctccaatcagctcagacaactga

DBGET integrated database retrieval system