KEGG   Ictalurus punctatus (channel catfish): 108266195Help
Entry
108266195         CDS       T04658                                 

Gene name
hdac4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108266195 (hdac4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ipu03036]
    108266195 (hdac4)
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     108266195 (hdac4)
Chromosome and associated proteins [BR:ipu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     108266195 (hdac4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 108266195
NCBI-ProteinID: XP_017324722
UniProt: A0A2D0R268
LinkDB All DBs
Position
6
AA seq 1093 aa AA seqDB search
MSSHSHPEPHCEMDLWEDDRDPQIKLKDSLSSKEQPLELLKPSGLNHIPSVDVSAVLPVA
VPPAAIPMDLRVDQQHLPVSGEQQLQQELLALKQKQQIQRQMLIAEFQRQHEQLSRQHEA
QLQEHIKHQQELLAMKHQQELLEHQRKLERHRREQELEKQQREQKLQLLKNKERGQESAV
ASTEVKMRLQEFVLNKKKALAQRSLNHCMPNDPRYSYWKTQHSSLDQSSPPQTGMSTYNH
PVLGLYDSKNDFPLRKTASEPNLKLRSRLKQKVTERRSSPLLRRRDGPVTTAKKRSLDVT
ESACNSAPGSGPSSPNNSSNNITNENGITSSISNSPVETSLAHRLASREGPVSQLSLYTS
PSLPNITLGLPATGSTTVASGQQEGERLAIAGLQPGLPITTPFIAGAHLPSYLAASALER
EAGSAHNPLLQHMALLEQSQNPLVSGLSGLPLQSPSIHKLRPHRPLGRTQSAPLPQNTQA
LQQLVVQQQHQQFLVKQKQHFQQQQLHISKIMATKPNEPGRQHESHPEETEEELREHQAL
NDPAEGLPRGITIKQEPPDQLEEELQHRERQAEHELIFRQQALLLEQQRIHQLRNYQASM
EAAGLSVTLPGHRPLSRAQSSPASATFPIVVQEPPAKPRFTTGLVYDTLMQKHQCMCGNT
NTHPEHAGRIQSIWSRLQETGLRSKCECIRGRKATLEELQTVHSEAHVLLYGTNPLRQKL
DSKTHTYKYLYTHVLMIMPFNDSFSQRAWQAAAVDPVQLGEKQKVDSDTIWNEVHSSSAA
RLAVGSVVELVFKVTSGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNV
SKILIVDWDVHHGNGTQQAFYSDPNVLYLSLHRYDDGNFFPGSGAPDEVGSGPGVGFNVN
MAFTGGLEPPMGDVDYLAAFRTIVMPIANEFAPDVVLVSSGFDAVEGHPPPLGGYKLTAK
CFGYLTKQLMGLAGGRLVLALEGGHDLTAICDASEACVSALLGNELEPLPEKVLQQRPNL
NAVRSMEKVLEAHSKYWRCLQRSVSTLGYSLIEAQKCETEEAETVTAMASLSVATKNMGK
RSEEEPMEEEPPL
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atgagttcccatagtcacccagagccacattgtgaaatggatctgtgggaagatgaccgt
gacccccagatcaaactaaaagatagcctttccagtaaagagcagcctctggagcttctc
aaaccatctggactcaaccacattccctctgttgatgtgagtgcggtgttgcccgttgcc
gttccccctgctgccatcccgatggatctgcgtgtggatcagcagcacttgcccgtgtct
ggggagcagcagctgcagcaggagctcctggcactcaaacagaagcaacagatccagagg
cagatgctcattgccgagttccagcggcagcacgagcagctctcacgccaacacgaagcc
cagctgcaggagcacattaagcatcagcaggagctgttggctatgaagcatcagcaggag
ctgctggagcaccagaggaagttggagcggcatcgtcgtgagcaggagctggagaaacag
cagcgcgagcagaaactgcagctgctcaaaaacaaggagcgtggccaggagagtgcggtg
gcgagcacagaggtgaagatgcgtcttcaggagtttgtgctgaataagaagaaagctctg
gcccagagaagcctcaaccactgcatgcccaacgacccacgctactcatactggaaaacc
cagcacagttcactggatcagagttctcctcctcagacagggatgtccacttacaaccac
ccagtgctgggactctacgattccaaaaacgactttccacttcgcaagacagcgtcagag
ccgaatctgaagctgcgctccaggctgaagcagaaggtgacggagcgacggagcagcccg
ctgctgcggaggagggacggacccgtaaccacggccaagaaacgctctctggatgtgacc
gaatcagcttgtaacagtgcacccggttctggcccgagctcacccaacaacagctccaac
aacatcactaacgagaacggcatcaccagctcaatctccaacagtccagtagagacttcc
ctggcacatcgtcttgccagcagagagggtcctgttagccagctgtctctgtacacatcc
ccctccctcccaaacatcactctgggcttgccagccaccggctccaccactgtggcatct
ggccagcaggagggtgagcggctggcgatagcaggcctgcagcccggattacccataacc
actccattcatcgcaggagcccaccttccctcatatctggctgcctctgccttggagcga
gaggcaggctcggcccacaaccctctgctgcagcacatggccctgctggagcagtcacag
aatcccctggtttcaggtctgagcggtctgcccctgcagtcaccctccatccataaactg
cgtcctcaccggccgttgggccgaacccagtcggcgccgctgccccagaacacacaggcc
ctgcagcagctcgtggtccagcagcagcaccagcagttcctggtcaaacagaagcagcac
ttccagcagcagcagctccacatcagcaagatcatggccactaaaccaaatgaaccaggc
aggcagcacgagagtcacccggaggagaccgaggaggagctgagggagcatcaggctctg
aacgacccagctgaaggcctgccacgcggcatcaccatcaaacaggagcctcccgatcaa
ctggaggaggagctgcagcatcgagagagacaggcagagcacgagctgatcttcagacag
caggccctgctcttggaacagcagagaatccatcagctaagaaactaccaggcatcgatg
gaggccgccggcctgtccgtcactttaccagggcaccgccccctgtccagagctcagtcc
tcgccagcctctgccacattcccgatcgtagtgcaggagcctccggctaagccacgtttc
actaccgggctggtgtatgacactctaatgcagaagcaccagtgtatgtgtggcaacact
aacacccacccagagcacgcgggccgaatccagagtatctggtccagactgcaggagacc
ggactgcgcagcaagtgtgagtgtatccggggcaggaaggccacgctggaggagctgcag
acggtccactctgaagctcacgtgctgctctacgggaccaacccactgagacagaaatta
gacagtaagacccacacatataaatatctgtatacacatgttttaatgatcatgcctttt
aatgattccttctctcagcgggcctggcaggctgcagcagtagacccggtgcagcttggt
gagaaacagaaggtggacagtgacactatctggaacgaggtacactcgtccagcgcggct
cgtctggccgtcggctccgtggtggaacttgtgtttaaagtgacgtctggagaactgaag
aacggtttcgctgtggtacggcctccaggacaccacgccgaggagagcacccccatggga
ttctgttatttcaactcggtggccatcgctgccaaactcctccagcagcgactgaatgtc
agcaagattttgatagtggactgggacgttcaccatggcaacggcacccagcaggctttc
tacagtgaccccaatgtgctgtatctgtctctgcatcgctatgacgacgggaacttcttt
cctggcagcggcgctcctgatgaggttggctcggggcctggtgtgggcttcaacgtgaac
atggcgttcacaggcggtctggagcctcccatgggagacgtggactatctggctgccttc
agaacgatagtgatgcctattgctaatgagtttgcacctgatgtggttctggtttcgtcg
gggttcgatgctgtggagggccacccgccaccactggggggatacaaactcacagccaag
tgttttggctacctgaccaagcagctgatgggcctggccggcggccgcctggtgctcgcc
cttgaggggggtcacgacctcactgccatctgcgatgcgtctgaagcatgtgtttctgct
ttgctaggaaacgagttggaaccactacctgagaaggttcttcaacagaggcccaatctc
aatgctgtgcgctccatggagaaggttctcgaagcccatagtaagtactggcgctgtctg
cagcgcagtgtttcgacgctgggctactccctgatcgaggctcagaagtgtgagacagag
gaggctgagactgtaaccgccatggcctcattgtctgtagccaccaagaacatggggaaa
cggtctgaagaggagccaatggaggaagaaccaccactgtag

DBGET integrated database retrieval system