KEGG   Ictalurus punctatus (channel catfish): 108266829Help
Entry
108266829         CDS       T04658                                 

Gene name
gad1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00250  Alanine, aspartate and glutamate metabolism
ipu00410  beta-Alanine metabolism
ipu00430  Taurine and hypotaurine metabolism
ipu00650  Butanoate metabolism
ipu01100  Metabolic pathways
Module
ipu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    108266829 (gad1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108266829 (gad1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108266829 (gad1)
   00430 Taurine and hypotaurine metabolism
    108266829 (gad1)
Enzymes [BR:ipu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     108266829 (gad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS Chlam_OMP3
Motif
Other DBs
NCBI-GeneID: 108266829
NCBI-ProteinID: XP_017326094
UniProt: W5UAL4
LinkDB All DBs
Position
6
AA seq 592 aa AA seqDB search
MAAPTAPSSSSSSSCGGEPNPNTTNLRPPASSYDWTGVAHGCTRKLGMKICGFLQKNNNL
DEKSRIVASLNEQSSPQKLGLQDSRFRRDDTDFSNLYARDLLPAKNGEEPTIQFLLEVVE
ILTNYVRKTFDRSTKVLDFHHPHQLLEGIEGFNLELADQPESLEQILVDCRDTLKYGVRT
GHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIVGWPNG
EGDGIFSPGGAISNMYSVMIARYKHFPEVKTKGMTAAPRLVLFTSEHSHYSIKKASAVLG
FGTENLILLSTDERGRVIPADLEAKVVDAKCKGYVPFFVSATAGTTVYGAFDPISEIADI
CEKYNMWLHVDGAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVPLQCSAILVREKG
LLQGCNSMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEKHIDR
CLELSEYLYTKIKNREGFEMVFQGQPQHTNVCFWYIPPSLRGMPDKEERRQRLHKVAPKI
KAMMMECGSTMVGYQPQGDKVNFFRMVISNPAATRSDIDFLVDEIERLGLDL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccgacggctccttcctcctcctcctcctcctcttgcggcggcgagcccaac
cccaacacgacaaatttacggccacctgcgtcaagctatgattggactggggttgcacac
ggatgtacgagaaagctcgggatgaagatatgtggatttttgcaaaagaacaacaatctt
gatgaaaagagtcggattgtggcttctctgaatgaacagtcatcaccacagaagctcggt
ttacaggactcacgcttccggcgtgatgacacagacttctccaacctgtatgcaagggat
ttactgcctgccaagaatggtgaagagcctacaatccagttcctactggaagtggtggaa
attctcacaaactatgtacggaagacatttgacagatccacgaaagtgctggacttccac
catccacaccagctcctggagggtatagagggctttaacttggagctcgcagaccagccc
gagagcctggagcagattcttgtagactgcagagacacactcaaatatggtgtcaggaca
ggtcatcccaggttttttaaccaactgtctactgggctggacatcattggcttggctggg
gaatggctcacctcaactgcaaacactaatatgttcacatatgaaattgctccagtgttt
gtgttgatggaacagctgactctgaaaaaaatgagggagattgttggctggccaaatgga
gaaggagatggaatattctccccaggaggagcgatctctaacatgtacagtgtgatgata
gctcgctataagcacttccctgaagtgaagactaaaggcatgactgcagccccaaggctc
gtgttgttcacttctgaacatagtcattactccataaaaaaagccagtgcagttctcggc
tttgggacagagaacctgattctgctgagtacagatgagagaggtagagtcattcctgct
gatttggaggccaaggttgttgatgccaaatgcaagggctacgttccattttttgtgagt
gccacagccggtactacagtttacggtgctttcgaccccatcagcgagattgcagatatc
tgtgagaaatataacatgtggctccatgtggatggagcatggggaggtggactgttgatg
tccagaaagcacaggcacaaacttaatggcattgagagggcaaattctgttacatggaat
cctcacaagatgatgggcgttccactacagtgctctgccattctggtcagagagaaggga
cttctccagggctgcaactctatgtgtgctggctatcttttccaacctgataaacagtat
gatgtctcctatgatactggagacaaggccatacagtgcggccggcatgtggacatcttc
aagttctggctcatgtggaaggcaaagggtaccattggattcgaaaagcatatagaccgg
tgtctggagctctcagagtatctctatacaaagatcaaaaatagagaaggctttgagatg
gtgttccagggacagcctcagcatactaatgtgtgcttctggtatattccaccgagcctg
cgtggcatgccagataaagaggagaggaggcagaggctccataaggtggctcctaaaatc
aaggcaatgatgatggagtgtggctcaacaatggttggctaccagcctcaaggtgacaag
gtcaacttcttcaggatggtcatttccaaccctgctgccaccaggtcagatatcgacttc
ctggtcgatgagattgaaagactgggcctggatttataa

DBGET integrated database retrieval system