KEGG   Ictalurus punctatus (channel catfish): 108267177Help
Entry
108267177         CDS       T04658                                 

Gene name
setd2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108267177 (setd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ipu03036]
    108267177 (setd2)
Enzymes [BR:ipu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108267177 (setd2)
Chromosome and associated proteins [BR:ipu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108267177 (setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 108267177
NCBI-ProteinID: XP_017326659
UniProt: A0A2D0R7U5
LinkDB All DBs
Position
1
AA seq 2675 aa AA seqDB search
MDALLNPELREKTLDGSIKVENTSKQVIFKGLAPRVVLTNHLLPKGTKTKVNLEEQGRQK
VSFSFTQSKKPRQKVFLVPPSPEKAASEISPVLPSADLTEQSDESKNEQIDSSVVTTVVA
ESQATQSPVPLTSKSKHDKVHFKKQILSVSIVEHPTVSAVLNDTTSETEVLIRSSARIEG
EPSVAPFQHSSVTDCSEEVNREESAQEKFDTCLKGPTDSSHIGKECKDSVSEPEHSKHVR
QSDSSLPGSDFDGESVRTSSQKSSDSKNVAKSDGQSAVVKKSSSSKNEVSDKSRSDKREE
KDEKGSSRCKSERDTRHTSSRSSRSDRRRTKSRSRSRSRSSRTSSSYSRSERSRNERLSR
SDRSHYHDSERRSHRSSRERRRSRSRGDGRSRDSSDSEDDLRKPRTRGSDSSRSSTYSSS
QRDSKTSSHSKSYRDSKSSPHSSESDKRTQYSRTEKSGRTSGSEPSKRSSPETDARHKRP
SSHSKSEVDGKTSSSNNVSRPEKKKTSGSSDSDDEHKTKTRFQGSDRFTRSSVKKTNNSE
AKSSSIETGGQLVAKLNINAKLPHLGSDKIKSQGEFNKVDVRSQHEESSQSKLTNNSFQQ
KQQDIVKDSFKSHVEFQDVNKVSDVAEKWPAVGEVNISKCQVTLKDASLDDDQLGKQTDI
LIQNKVQILKEAQTNVANVDAFFKTDDLSSLNEPPYPGYTPSQDSLGSLAGTLSVKELPP
GECLKSNTKFVSQLLLSTEVSRLPMNVETSQKGTEQSDIKLEQTTAVVLKNKGAHVKKSR
WDIVGQDTSENQTPQKTVSNETSSVKKVISVKKIEFNSDGGHEEKCSRSMIDSLKSELDE
QTDEATTTDSEKEIKQDPDQPFAADTQQPNDEGSDHLADRSLANQVNLKPNCTPEVVIHV
DQKYANSDELNSNNSYKPLTQESVPFNCDGKSHSEESETDDSDSDSDDGQMSLKRLHSVV
VVPKNSTITLETTDQPTPPASPSALSGQHQLTYRADESSISINSEIPSILNTPIKPVECS
AEESKHDILSVAENKCMPSVQMSYQSQSDLVDSTSQSEATTTLAHTNRNCTVKERPKTCV
STDQVPTCTRRAAESGCHQYHDNPDSWHDRKGGREQFGDFSCTDNLRPQNGLNLSCDFIQ
TEQPSSTFQQPDSSHSTQRPSQIGSAFIRQDSGYWTQANVSEKSMPVNTLVPSPCHEAMC
QIHPDSLTNDHEEDYVGKAFGLGGGVIPSRNTPVSSAFVQANEISSNCSFVTATVESQII
SEPPREGSQKPHRGRGPPKKRRPELESESDNEAEAGLAFKRECLEERERCKDAKETKVSS
QQEEQRPLLSLKEFLDPAVWKERAKHKKMPPYFDLIEENVYLTERKKNKSHRDIKRMQCE
CAVLSREERAQGVMACGEDCLNRLLMIECSSRCLNGVYCSNRRFQMKQHADFEVILTESK
GWGLRAAKDLPPNTFVLEYCGEVLDHKEFKSRVKEYARSKNIHYYFMALKNNEIIDATLK
GNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKVVKTGTELTFDYQFQRYGKEAQKCYC
GAPSCRGFLGGENRVSVRASVGKKQRERSRKKEAVSALTTVDEELEALLENGEGLSDEKQ
VVSLCRLMVRVETMEQRLTCLKLIQNTPNSSCLKQFLDHHGLSLLWIFMVDFSEAKSNSA
NNIKLQMEIMKALAVLPISTKNMLEESRVLQYIQRWAQSHPLGQPTEQDGYSSESTSRAH
TPLNTPDGPPAKLAPEMDGDTPKRAVYRRLKIISENSLDSALSDGSKVSDGKEEEDEEEE
EVEEEPSQEVTAGAAEKQETSEEMAVTPEPLVKQEASDSVESSQTKLELKEEDGEQEKTE
VQETEEKPTSKTGENLPALMEGNCESEPAEVKSHVQTPAIDHPATDHPPDAASVKAEEDA
SPSTHPPDESTPSSESSSENEGAEPSVTNIISPSTVSSVPTEPVDVNMPSDGMETTPSES
TVNPEPSPLNLDNIPPSSGTSSAEKALAEVSAVTVESSPSVSAVGTAEVLPLGIVATEGA
AVGTPSQDEEEAVSDVESERSQEPQIGAADISEMATRLLDSWKDLKEVYRIPKKSQVEKE
SNDRSRDREALLTPRTSSSSRERERDRDRERERERDWDRERDWDREKDSDRSLLRSTERR
RRRGSASPPYPSPYERSSRRNEDRYDSGSSSKKPRTKEARTKLTTEERRKLFEQEVAQRE
AQKQQQQQQQQQQQQQQQQQQQQLQRLAFNPLVYPSSPGFMTYPPGYPIQTYVDPTNPNA
GKVLLPTPPMEPMCVTPAGTVAFDQTTQPLISDLTLAAQSPSTTQASSATSLAHVPTTLE
LASSAQPQQFVQPAVPAQDPGVTVLSVPTQTAGTQVQGQQGYTTLWDPNTQQAVTVQPAQ
QYSNTAQPQTAIYYQGQPCQAIYSIPAGYPQTSTPVIQTYTEPATGYLHGQQVYAGHQQG
VVVQQGGTVTTIVTSQTVQQEMIVPNNIMDLPPPSPPKPKTIVLPPSWKVARDPEGKIYY
YHIVTRQTQWDPPSWDGVGEEANVEHEAEMDLGTPTYDENPSKFSTKTAEADTSSELAKK
SKEVFRKEMSQFIVQCLNPYRKPDCKLGRISNTEDFKHLARKLTHGVMNKELKSCKNPED
LECNENVKHKTKEYIKKYMQKFGAVYRPKEDTEME
NT seq 8028 nt NT seq  +upstreamnt  +downstreamnt
atggatgcactgctgaatcctgaactcagggaaaagacgcttgatggttcgatcaaggtt
gaaaacacctcaaagcaagtcatttttaaaggtcttgctcctagagttgttttaacaaac
catctcctgcctaaaggaacaaagactaaagtgaaccttgaggaacagggtcgacagaag
gtctctttcagcttcacccagagtaagaagccacggcagaaagtgttccttgtcccacca
agtccagagaaagctgcaagtgaaatttctcctgtattgccctccgcagacctaacggaa
cagagtgatgaaagcaagaatgagcaaattgattcctctgttgtgaccacagtcgtggcc
gagtcccaggcaacacagtccccagtacccctcacctccaaatcgaaacatgacaaggtg
cattttaagaaacagattttgagtgtatctattgttgaacatcccactgtcagtgctgtt
ttaaatgataccacttcagagactgaagttttaattagatcttcagcaaggattgaaggt
gaaccctctgtggctccgttccaacacagctctgtgactgactgttctgaagaagttaac
agagaggaaagtgctcaggagaaattcgacacttgccttaagggaccaactgattcctcc
catattgggaaagagtgtaaggatagtgtttctgagcctgaacacagcaaacatgttcgt
cagtcagacagttctctgccaggttctgactttgatggcgagtctgttcggacatctagc
caaaagtctagtgattccaagaatgtggcaaagagtgatggtcagagtgctgttgttaag
aagtcctcgagctcgaaaaacgaagtctcagacaaatccagatcagataagcgagaggag
aaggatgaaaaagggtctagtcgatgtaagtcagagagagacactagacacacatcgtca
cgatcttctcgttctgaccgaaggaggaccaagagtcggtcacgatctagatcccgaagt
tctcgaacgagttcttcctactccagatctgagagatcaagaaatgaaagactgtcaagg
tcagataggtcacattaccatgattccgaaaggagatcccacagaagttctcgtgaacga
aggaggtcccgctcccgaggtgatggcagatctcgagacagctctgactctgaagatgac
ctcaggaagcccaggactcgaggcagtgattcaagccgatcctcaacatactctagctcg
caaagagattccaagacatcctctcattcaaaatcctacagagactcaaaatcttctcct
cactcgtcagaatcggacaaaagaacacaatactcaagaacagagaaatctggtagaact
agtggctctgaacctagtaaaaggagttctcccgagactgatgctcgtcataaaaggccc
agttcccattcaaaatcggaggtagatggtaaaacatccagttcgaataacgtgtcaaga
cctgagaaaaagaaaaccagtgggagttctgactctgatgatgagcacaaaacaaaaacc
cgatttcaaggttcagatcggtttactaggtcatctgttaaaaaaacaaataattcagag
gcaaagtcaagtagtattgaaacaggtggacaactagtagcaaaactaaacatcaatgct
aaacttccacacttgggttctgacaaaatcaagtctcagggagaattcaacaaggtggat
gttcgttcccaacatgaagaaagcagtcagtctaaattaacaaataattctttccaacaa
aagcagcaagatatcgtaaaggacagttttaaaagtcatgttgaatttcaggatgtgaac
aaagtttctgatgttgcggaaaagtggccagctgtcggtgaagtaaatattagtaaatgt
caggttactctcaaggacgcatctttagacgacgatcaacttggaaagcagacagacatt
ctaattcaaaataaagtacagatcttgaaagaggcacagactaatgtggcgaatgttgat
gcctttttcaaaactgatgatttgtctagcttgaatgagccaccttatccaggctacacc
cccagtcaggattctttgggttcattggcaggcactctttctgtgaaagaattaccacct
ggagaatgcttgaaatcaaacactaaatttgtttcccagttgcttctcagtactgaagta
agtcggctgccgatgaatgtcgaaacctctcaaaaaggtacagagcagtcagacatcaag
cttgaacagactactgctgtggttctaaaaaataagggtgcccatgttaaaaagtcacgg
tgggatattgttggtcaagacacttcggaaaatcagaccccccaaaagactgtaagcaat
gagacttcctctgtgaaaaaggtcatttcagttaagaagatagaatttaacagtgatggt
ggccatgaagaaaaatgctcaagatctatgattgattcactaaagtcggagctggacgag
cagacagatgaggcaacaacgaccgattctgagaaagaaatcaagcaagatcctgatcag
ccatttgctgctgatacacagcaacccaatgatgaaggtagtgatcatttagctgacagg
tctctagcaaatcaggttaatctgaaacctaattgcactccagaagttgttattcatgtt
gatcagaaatatgccaattctgacgaattgaacagcaataactcgtataagcctttgact
caagagtctgtgccattcaattgtgatggtaaaagccacagtgaggaaagtgaaactgat
gactcagactccgattcagatgatggacagatgtctttgaagcggctacactctgtggtg
gttgtgccaaagaattctactattacccttgagacaactgaccagccaacaccaccagct
agcccatcagctctatctgggcagcatcagctaacttatcgggcagatgagtcgagtata
agcattaacagtgaaattcctagtattctcaacactccaatcaaacctgtggaatgttca
gctgaagaaagcaaacacgacatcctgtcagttgctgagaataaatgtatgccttctgtg
caaatgtcctaccagtcccagagcgacttggttgacagcactagccaatctgaggcaacc
acaaccctagctcacacaaacaggaactgcactgtcaaagaaagaccaaagacttgtgtc
tcaactgaccaagtacctacctgtactcggagagcggctgaatcaggttgtcaccagtat
catgacaatccagacagctggcatgatagaaaggggggaagggaacaatttggagacttt
agttgcacagataatctcaggccccagaatggtttgaacctgtcttgtgacttcatccaa
acagagcagcccagcagcacatttcagcagccagacagcagtcacagcacacaacggcca
tcccagataggaagtgcatttatcaggcaagatagtggttactggacccaggcaaatgtc
tctgagaaaagcatgccagtcaatacacttgtgccttctccttgtcatgaggcaatgtgc
cagattcaccctgactctttaactaatgaccatgaggaagattatgtggggaaagcattt
ggacttggtggtggagttataccatctagaaacactccagtctcctctgcatttgtccaa
gccaatgagataagcagcaattgcagctttgtaacagccactgttgagagtcagataatc
tcagagcctccaagggaaggcagccaaaagcctcatagaggcagaggcccacccaagaaa
agacgtccagaactggagtccgaatcggacaatgaggcagaggcaggtcttgcttttaag
cgagaatgcctagaggagcgtgagcggtgcaaggacgcgaaagagaccaaggtatcctca
cagcaagaagaacaacggccattgcttagtctgaaagaatttttggatcctgctgtctgg
aaggaaagagcaaagcataaaaagatgcctccttattttgatctcattgaggaaaatgtc
tacctgacagaacgcaagaagaataagtctcatcgggatattaagcgaatgcagtgcgag
tgtgctgtcctttcaagagaggagcgggcacagggagttatggcttgtggagaagattgt
ttgaatcgcctgctgatgatcgaatgctcgtcacggtgcttaaatggagtatattgctca
aaccggcgctttcagatgaagcagcatgcagattttgaagtaattctcactgaaagcaaa
ggctggggtttgcgggctgccaaagacttaccgccgaacacatttgtgttggagtattgc
ggtgaggttctggatcacaaggagttcaagtcacgggtaaaagagtatgctcgcagcaag
aatatccactactacttcatggctttgaagaataatgagatcattgatgccacactgaaa
ggcaactgctcgaggtttatgaaccacagctgtgagcccaactgtgaaactcagaagtgg
acagtgaatggtcagctcagagttggcttcttcaccaccaaagttgtgaagactgggaca
gagctcacttttgattaccagttccaaagatatgggaaagaggcacaaaagtgttactgt
ggagcaccgagttgccggggcttcctgggtggagagaatcgtgtcagtgtacgggcatct
gtggggaagaagcagagggaacggtcgaggaagaaggaagctgttagtgcactgactaca
gtggatgaggagctagaggctctgctagagaatggggaaggtctgagtgatgagaaacaa
gtggtctcactctgcagactaatggtgcgtgtggagaccatggagcagagactcacttgt
ctgaaactcatccagaatactccaaattcttcatgcctcaagcagtttttggatcatcac
ggtctgtcattgttatggattttcatggttgatttctctgaagccaaaagcaactctgct
aataacatcaaactgcagatggagataatgaaggcactggcagtgctacccatttctact
aagaacatgctggaagagagccgtgtgctacaatacatccagcgctgggcccaaagccat
ccacttggccagcctacagagcaagatggttactccagtgagagcacctcccgagcccac
acacctctcaacacccctgatggcccccctgccaaactggcaccagagatggatggagac
acaccaaaacgtgctgtctaccgcagactgaagatcatcagcgagaacagcctggatagt
gcgctctcagacgggagcaaagtctctgatggtaaagaggaagaagacgaagaagaggag
gaggtagaggaggagccctcgcaggaggtcacagcgggcgcagcagaaaaacaagagacc
agcgaggaaatggctgtgaccccagagccactagtgaaacaggaagcttcagattctgtg
gagagtagtcagacaaaactagagctaaaggaggaggatggtgagcaagaaaaaacagaa
gtgcaggaaactgaggagaaaccaactagcaagacaggtgagaacctgcctgctctcatg
gaggggaactgtgagtctgagcctgcagaagttaaaagtcacgtgcagacacctgccata
gatcaccctgccacagatcaccctcctgatgctgccagcgtcaaagctgaagaagacgcc
agcccctctacgcatccccctgatgaaagcactcccagctctgagtcttcttcggagaac
gagggcgccgagccttcagtcacaaacataatatctccttccaccgtcagcagtgtgcct
acagaacctgttgatgtcaacatgccttcagatggtatggaaaccacaccttctgagtca
acagttaaccctgaaccttcacctctcaacttggacaatattccacctagttctggtacc
agctctgcagagaaagcattagctgaagttagtgctgttactgtcgagagcagtccttca
gtttcagctgttggcacagcagaggtactgccactgggaatagtggcgacggagggcgca
gcagtgggtacaccttcccaggatgaggaggaggctgtgtctgatgtggaaagtgagaga
agccaagagcctcagatcggagctgctgacatcagtgaaatggccacccgcctactcgac
agctggaaagacctgaaggaggtgtacaggatcccaaagaagagtcaggtagagaaagaa
tcaaatgatcgtagtcgggacagggaggcactgctgacaccccgcacctcctccagtagt
cgagaaagagagcgggatagggaccgagagcgggaaagagagcgtgactgggaccgagag
cgagactgggaccgagaaaaagactccgacaggtcgttgctacgtagcaccgaaaggcgg
cgtagacgaggctctgcctctcccccgtacccgtctccctatgaaagaagtagccgcaga
aacgaagaccgatatgattcaggcagcagtagtaagaaacctcgaaccaaggaggctcgt
accaagctcaccacagaggagcgacggaagctcttcgagcaggaggtggctcagagagaa
gcccagaaacaacagcagcagcagcagcagcaacaacagcagcagcagcagcagcagcaa
caacagcagctacagagactagcattcaatcctcttgtgtatccctcgagtccaggcttc
atgacctatccccctggctaccctattcagacatatgtggacccaacaaaccccaatgcg
ggcaaggtgctattacctacaccgcccatggagcctatgtgtgtgactccagctggcaca
gttgcctttgatcagactactcagccactcatttctgacctgactctggcagctcagtcc
cccagcaccactcaggccagctcagccacaagtctggcacatgtgcctactacactggag
ctggcatcttctgcccagccacaacagtttgtccagccagctgtgccagctcaggaccct
ggcgtcactgtcctgtcggttcctactcagacagccggcacccaagtgcagggccagcag
ggctacacaacactttgggatcccaatacacagcaggcagtgacagtgcaacctgcccag
cagtactcgaacacagcccagccacagactgccatctattaccaaggccagccatgccag
gcaatctacagcattcctgcaggttaccctcagaccagcactcccgtcattcagacatac
accgagccagccactggctacctacacgggcagcaggtctacgctggtcaccagcaggga
gtggtggtccagcaaggtggcacagttactaccatagtcacatctcaaactgtacaacag
gaaatgattgtacccaataacatcatggacctgcctcctccttcacctcccaaacctaaa
accattgtcctgcctcccagctggaaggtagcacgggatcctgagggcaagatctactac
tatcatatagtcaccaggcaaacccagtgggatcctcctagctgggatggagttggggaa
gaggccaacgtggagcacgaggctgagatggacttggggacaccaacatacgatgaaaat
ccctcaaagttctccaccaagacagctgaggcagacacctccagtgagcttgcaaagaaa
agcaaagaggtcttccgcaaagagatgtcgcagtttattgtacaatgccttaatccatac
cgaaagcctgactgcaaactgggccgcattagcaacactgaagatttcaaacatcttgcc
aggaagttgactcatggagtgatgaacaaggagctcaaatcctgcaaaaaccctgaggac
ctggagtgcaacgagaacgttaaacacaagaccaaggaatatattaagaagtacatgcag
aagtttggagctgtttaccggcccaaagaggacaccgagatggagtaa

DBGET integrated database retrieval system