KEGG   Ictalurus punctatus (channel catfish): 108267596
Entry
108267596         CDS       T04658                                 

Gene name
epo
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108267596 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ipu04052]
    108267596 (epo)
Cytokines and growth factors [BR:ipu04052]
 Cytokines
  CSF and other factors
   108267596 (epo)
SSDB
Motif
Pfam: EPO_TPO DUF2830
Other DBs
NCBI-GeneID: 108267596
NCBI-ProteinID: XP_017327325
UniProt: A0A2D0RBS5
LinkDB
Position
7
AA seq 193 aa
MDVTGHKERSKTIKRSAGLLALLLIILEWIRPGLPSPLRPICDLRVLNHFIKEARDAEAA
LRFCTEECSIAVPLTVPLTRVDFDVWEKQNTEEQAQEVQTGLWLLNMAISSLGASITNSA
LHSHIEASIRNIASLKQVLRSLSIQDYVPTSGGTEDTWKVSSASELFQVHINFLRGKVRL
LLSNAPICQQHIR
NT seq 582 nt   +upstreamnt  +downstreamnt
atggatgtaactggacacaaggagaggtcaaagactataaagagatctgctggactcctt
gccttgctgctgatcatactggagtggattcggcctggcctaccctcccctttgcggcct
atctgtgacctgcgtgttctcaaccacttcattaaggaagcacgggatgctgaggctgct
ttgaggttttgtacagaggaatgcagtattgctgtacctctcacagttcctctgaccaga
gtggattttgatgtttgggaaaagcaaaatacagaggagcaggctcaagaagtgcagaca
ggactatggttgctaaacatggccatcagctcattaggtgcatccatcaccaactctgca
ctccactcccacatagaagccagcatcagaaacattgccagcctcaagcaggtgctgcgc
agcctcagtatacaggactatgtgcctacaagtggtgggacagaggacacatggaaagta
tcttcggcctcagagctcttccaggtccacatcaacttcctgcgtgggaaagtgcgcctt
ttgctctccaatgctccaatctgccagcagcatatcagatga

DBGET integrated database retrieval system