KEGG   Ictalurus punctatus (channel catfish): 108269259
Entry
108269259         CDS       T04658                                 

Gene name
kitlg
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
ipu04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108269259 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    108269259 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ipu04052]
    108269259 (kitlg)
Cytokines and growth factors [BR:ipu04052]
 Growth factors
  Growth factors (RTK binding)
   108269259 (kitlg)
SSDB
Motif
Pfam: SCF DUF1180 DASH_Dad4
Other DBs
NCBI-GeneID: 108269259
NCBI-ProteinID: XP_017330508
UniProt: W5UG09
LinkDB
Position
8
AA seq 273 aa
MKKSKIWIRTCVHLLLYITVAAYSSEIGNPITDDIKKISLLKQNIPKDYKITVQYLPKEV
SGMCWVKLNVFHLEESLKDLSQKFGNISSNKDYIETFVQMLKEMRYIIGHDLENSMLEFQ
CHYREEKWLTPRYFKFVEDFFNTANSSREVEDCEPPPCPTTIKTKVTTTTATAAPTQQHS
QGGSSSIENTNQSEGFMKPMTFPPIVKRSLFSLLFIPAVVAVLLLVWKVKSRRNTPSAQS
STEAPPLFIGAEPSAPPLDDEISENKRLNICTV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaatttggatacgtacctgtgtccatttgttgctttacatcacagtt
gctgcctattcgagtgaaatcggaaatcccataacagatgacatcaagaaaatttcatta
ctgaaacagaatattccgaaagactacaagatcactgtacaatatttgcctaaagaagtg
agtggtatgtgctgggtgaagctcaacgtattccacttggaggagagcttaaaagacctg
tcccagaagtttgggaatatttcctccaacaaagattacatagaaacgtttgtccaaatg
ttgaaagagatgcgatatatcattggacatgacttggagaattccatgctggagtttcag
tgccactacagagaggagaaatggctcacgccacgctatttcaaatttgtagaagacttt
ttcaacacagccaattcttcgagagaagtagaagactgcgaacctccaccatgcccaacg
acgattaaaacgaaagtaacgacaactacagcaacagcggcgccgacacagcaacattcg
caaggcggtagctcatctattgagaacacaaaccaaagcgaaggcttcatgaagccgatg
acctttccaccaattgtgaagaggagtctcttttcgctccttttcattcccgccgtcgtt
gccgtgttgctgctcgtctggaaggtgaaatctagaagaaacaccccatcggcgcagagt
agtacagaagccccgccgctgtttatcggagccgagcccagcgcaccacccttagatgat
gaaatatctgaaaacaaacgattaaacatctgcacagtgtaa

DBGET integrated database retrieval system