KEGG   Ictalurus punctatus (channel catfish): 108269767Help
Entry
108269767         CDS       T04658                                 

Definition
(RefSeq) neutral alpha-glucosidase C-like
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00052  Galactose metabolism
ipu00500  Starch and sucrose metabolism
ipu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108269767
   00500 Starch and sucrose metabolism
    108269767
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108269767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 108269767
NCBI-ProteinID: XP_017331247
UniProt: A0A2D0RL54
LinkDB All DBs
Position
9
AA seq 902 aa AA seqDB search
MAEFGVNKNASTDELQSVVGKGKFKRAEDILFYKRQKARAESQYCALLDTLVLQERAAAV
ELCESYSQEHLLLLIHEIPNGSLRFTIDELQPVQARYKAADVLIGEPEYEQLRIEWKRAD
CVSLTWGSGQYHVQVFAFPFHLEILYEDEAIVTFNPKGRLCFETLCNPARPSSSSYQGEE
NPLGLWKETFTQFQDTNAKGHSSVGIDLRLHGFSHAYGIPEHADSLQLKDTSGSEPYRLY
NLDVFAYEINSRLGLYGSVPLLLAHKADRTLGVFWLNTSETLVDLQYGSSYQEQGEDGPP
VKKSRENPQIDVGWVSESGQIDCFILLGPSPTQVFSQYAQLTGYQALPPLFSLGYHQCRW
SYKDEEDVKAVDAGFDCHTIPYDVIWLDIDHTEGKRYFTWDSKLFSNPVDMQLHLQRKKR
KMVVINDPHIKADPDWPFFCEARDGGHFVKDSNGGVYHGTCWPGDSCYLDFSSSRTRSWY
ARQFSLDKYKGSTESLFVWNDMNEPSVFNGPEQTMPKDVVHCSGWEHRELHNLYGFFQHM
ATVEGLITRSGGLERPFVLSRSFFAGSQRMGAVWTGDNVATWEYLKISIPMLLSLSVTGM
QFCGADVGGFVQNPDPELLVRWYQAGALQPFYRGHSDRRTKRREPWLFGSTVTSAVRSAI
QQRYCLLPYWYTLFHLAHTSALPPMRPLWVEFPKETETFTVENQYMIGSALLACPVTDPG
VTAVKILLPGSDELWYDVSNGEVHRGGKTLTLPVTLETVPVLQRGGTVVTRRTGCGSCTA
DLQQHPFTLTVAPDFEGNAEGMLYEDDGHSFSYRDKKQFCLRKFSLQTGRLISSCAAEEA
LFISGGKLESVVILGQKSVKRKPTLKSPAGKNTVSFQFEPKQALLTLTGLDLEIHTDWEI
RI
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtttggcgtaaacaagaatgcttctacagatgagctacagagcgtcgtgggt
aaaggaaaatttaaaagagccgaagacatcttgttttacaagagacagaaagccagagct
gagtctcagtactgtgccttactggacactttagtcctgcaagagagagcagctgctgtg
gagctgtgtgagtcctactctcaggaacatttgcttcttctaatccatgaaattcctaat
ggatctctgaggtttacgattgatgaattgcagcctgtccaagctcgctataaagctgca
gacgtcttgattggagaacccgaatatgagcagttgaggattgagtggaagagagctgac
tgtgtttctctgacctggggttcagggcagtaccatgtccaggtctttgctttccccttc
cacttagagattctctatgaggacgaggcaattgtcacatttaatcctaaaggcagactc
tgctttgagacactgtgtaatccagccaggccatcctccagttcatatcagggtgaagaa
aatcctttagggctgtggaaggagactttcacacagtttcaagacaccaatgcaaaaggt
cacagttcagtgggtattgaccttcggctccatggtttcagccacgcttatggtattcct
gagcatgcagattctctccagctgaaggacaccagtggcagtgagccgtatcgattgtac
aacctggatgtgtttgcctatgagatcaacagcagactggggctttatggttctgttcct
cttctgttagctcacaaggcagacaggacgctgggggtgttctggctcaacacctctgaa
actctggtagatctgcagtatggctcaagctatcaggagcagggagaggatggcccacca
gtgaagaagagcagggaaaatcctcaaatcgatgtgggctgggtgtcggagagtggacaa
attgattgtttcatactgcttggaccttcaccgacccaagtgttttctcagtatgcacaa
ctcacaggataccaagccttgccacctttgttttccctgggatatcaccagtgtcgctgg
agctataaggatgaagaggacgtgaaagctgtggatgctggcttcgactgccataccatc
ccttatgatgtaatctggctggacatagaccacactgaagggaaacgctacttcacctgg
gattccaaactgttttctaacccagtggacatgcagctccatttgcagagaaagaaaagg
aagatggtggttatcaatgatccccatatcaaggctgaccctgattggccttttttttgt
gaagccagagatggcggccattttgtgaaagacagcaatggtggtgtttatcatggaaca
tgctggccaggcgattcctgctacttggacttcagtagctcaaggacaaggtcgtggtat
gccagacagttttcacttgacaagtataaagggtctacagagtccttgtttgtgtggaat
gacatgaacgagccctctgtctttaatggaccagagcagacaatgcctaaagacgtggtt
cattgctcaggctgggaacacagggaattacacaacctgtatggctttttccagcacatg
gcaactgttgagggtttgataactcgctctggtggcttggagagaccatttgttctgtca
cgctccttctttgctgggtctcagagaatgggtgctgtatggacaggggacaatgttgct
acctgggagtatttgaagatctcaatccctatgctgttgtcattgagtgtcactggaatg
cagttttgtggggctgatgtaggaggctttgtgcagaatccagaccctgagttgctggtg
cgctggtaccaggcgggggcgctgcagcctttctatagaggccactcagatagacggacc
aagcggcgggagccctggctgtttgggagcacagtcacttcagcagtgagatcagcaatc
caacagagatactgcctcctgccttactggtacactctctttcacctagcccatacctca
gcattgcccccaatgagacctctgtgggtggagttcccgaaggagacagaaaccttcact
gtggaaaaccagtacatgattggcagtgcactcctggcctgtcctgtgactgacccagga
gtcacagcagtcaagattttactgccagggtcagacgagctgtggtatgatgtcagcaac
ggtgaggtgcacagaggaggaaagactctgacacttcctgtgactctggagacggtacct
gtgctgcagcgtggaggaacagttgtgaccaggagaacaggctgtggttcctgcactgct
gatctccagcagcatcccttcactcttactgtagctccagactttgagggcaatgcggaa
ggaatgctgtatgaggatgatggacactcgttcagctatagggacaaaaagcagttctgc
ttgcgtaaattctctctgcagactggtagactcattagcagctgtgcagctgaagaagcg
ctcttcatctctggtggcaaactggagtcagtggtgattctgggtcagaagagtgtgaaa
aggaaacctactctaaaatcacctgcagggaagaacacggtttcgtttcagtttgaacca
aagcaagctctgttgacgctaactggtttggacctggagatacacacagattgggaaatc
agaatataa

DBGET integrated database retrieval system