KEGG   Ictalurus punctatus (channel catfish): 108269941Help
Entry
108269941         CDS       T04658                                 

Gene name
gstz1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00350  Tyrosine metabolism
ipu01100  Metabolic pathways
Module
ipu_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    108269941 (gstz1)
Enzymes [BR:ipu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     108269941 (gstz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_C_5
Motif
Other DBs
NCBI-GeneID: 108269941
NCBI-ProteinID: XP_017331596
UniProt: A0A2D0RM58
LinkDB All DBs
Position
9
AA seq 223 aa AA seqDB search
MRTSFACLMKPVLYGYFRSSCSWRVRIAFALKGIEYDQVPINLVKDGGQQLTDQYKTVNP
MQQVPAVTIDGITLSQSLAIIQYIDETRPGPRLLPADVQQRAQVRMISDLIASGIQPLQI
TQNIYVIQKIGEEKVQWAQHFINKGFKALESILKQTSGTYCFGNEISMADVCLVPQVYNA
ERFKVDLDQYPTIKRINQTLMELEAFKGTHPSCQPDTPDDLRA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacatcatttgcatgtttgatgaagcccgtgctttatggatatttcagaagttct
tgctcatggagagttcggattgcttttgccctaaagggtattgaatatgaccaagtacca
atcaacctcgtcaaggatggaggccagcagctcacagatcagtataaaacagtcaaccca
atgcagcaagtaccagcagtcaccattgatggcatcaccttgtctcagtcactggctatc
atccagtatattgacgaaactcggcctgggccacgtctcctcccagctgacgtacagcag
cgagctcaagtgcgcatgatctctgatctcatcgcctccggtatacagcctctacagatt
actcagaacatctatgtgatacagaaaattggtgaagaaaaggtacaatgggctcaacat
ttcatcaacaagggattcaaggccctcgagtccatcctgaagcagacatctggaacatac
tgttttggaaatgagatatccatggcagacgtgtgtcttgtaccccaggtctacaatgct
gaaaggtttaaagtggatcttgaccagtatcccacaatcaagcggataaaccagacccta
atggagcttgaggccttcaaaggcactcatccatcctgtcagcctgatacacctgatgac
ctgagagcataa

DBGET integrated database retrieval system