KEGG   Ictalurus punctatus (channel catfish): 108271119
Entry
108271119         CDS       T04658                                 

Gene name
ccnd1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04068  FoxO signaling pathway
ipu04110  Cell cycle
ipu04115  p53 signaling pathway
ipu04218  Cellular senescence
ipu04310  Wnt signaling pathway
ipu04340  Hedgehog signaling pathway
ipu04371  Apelin signaling pathway
ipu04510  Focal adhesion
ipu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108271119 (ccnd1)
   04340 Hedgehog signaling pathway
    108271119 (ccnd1)
   04371 Apelin signaling pathway
    108271119 (ccnd1)
   04068 FoxO signaling pathway
    108271119 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108271119 (ccnd1)
   04115 p53 signaling pathway
    108271119 (ccnd1)
   04218 Cellular senescence
    108271119 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108271119 (ccnd1)
   04530 Tight junction
    108271119 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 108271119
NCBI-ProteinID: XP_017333900
UniProt: W5UF51
LinkDB
Position
10
AA seq 292 aa
MEHQLFCCEVDTIRRAYHDANLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVDYTKKTRLQLLGAACMFLASKMKETVPLT
AEKLCIYTDNSIRPCELLQMELLVLNKLKWDLASVTPHDFIEHFLTKLPIHQNAKQILRK
HAQTFVALCATDVNFIASPPSMIAAGSVAAAVQGLYLKGADSSLSSQNLTNYLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQQSISTESKRVEEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggagcaccagctgttctgctgcgaggtggataccataagaagagcttaccacgacgcc
aacttgttgaatgatcgagttttacagacaatgctcaaagcggaggaaaactatctcccc
tcgcccaattatttcaaatgcgtgcagaaagaaattgtacccaaaatgaggaaaatcgtc
gccacatggatgctagaggtgtgcgaagaacagaaatgtgaagaggaggttttccctttg
gccatgaactacttggacaggtttctgtctgttgattacactaaaaagacgcgactgcag
ctgctgggagccgcctgcatgttcttggcctccaaaatgaaggaaaccgtgccattaaca
gcagagaagctttgtatatacacggacaactccatccgcccctgcgaactattgcaaatg
gagctacttgttctgaataagctgaagtgggatctagcctctgtgacaccccacgacttc
attgaacattttctcaccaaactgcctattcatcagaacgccaagcagattctgcgcaaa
cacgcacagacgtttgtggctctctgcgcaacagatgtcaactttatcgcaagccctccc
tcgatgatcgctgcaggaagcgttgccgcagcagtgcagggactctacttgaagggtgcg
gacagttctttatcctcccagaacctcaccaactacctgtcccaagttatcaggagtgac
ccagactgtcttcgatcgtgccaggagcagatcgaatctctgctggagtccagtctgagg
caggcgcaacagcaaagcatctccacagaaagcaaacgtgtggaggaggacgttgatctc
tcatgcactcctacagatgtcagggacattaacatctga

DBGET integrated database retrieval system