KEGG   Ictalurus punctatus (channel catfish): 108271309Help
Entry
108271309         CDS       T04658                                 

Gene name
polrmt
Definition
(RefSeq) RNA polymerase mitochondrial
  KO
K10908  DNA-directed RNA polymerase, mitochondrial [EC:2.7.7.6]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ipu03029]
    108271309 (polrmt)
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     108271309 (polrmt)
Mitochondrial biogenesis [BR:ipu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial RNA polymerase
    108271309 (polrmt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol RPOL_N PPR_2 PPR_3 PPR_long
Motif
Other DBs
NCBI-GeneID: 108271309
NCBI-ProteinID: XP_017334298
UniProt: A0A2D0RUX0
LinkDB All DBs
Position
10
AA seq 1302 aa AA seqDB search
MSLLRLCAFPKYLNGRFMFERSARFTLNSNHCLNCLRLRNNCERGTRANPWTTLHQRHYS
AIPKKEDGKRRVWEQSHLLDVLEARMQQLQSDVLHVKHLKVEFVKVPKGEKRDAPVKSQK
TDAETSKAVQSTKKGTSSHNPPSKAHASRWIEKLKLEKSNKTKKQSSLQQKLRDKIGTAA
KSSKGNLMAPGTSIKTISIAKRCKQPEPESTTAPMPQSKHLQPKVSKRCTSATTMKADPE
KLSRTAELAEVEELEGMIGEWSPTNAEKLLEDKDGNRYGDAQLNLRCHLEACVFTGDVER
AQHSLFFHHRHLSKRKALSVSAYNIMMRLWAKKGSVNHIGRLFAMVEEAGLKPNLASYSA
ALECMGRNPDTSSRTINRCLQQMAESGLHLDDMFRQCVFRQDERDMVLKAIRTVQLDYEP
HTPSEQPRCSLPLVENFYTEREETSYPKLDFSVAELQERFRRQLAMEQANTITIDSVEAI
KPVTEHMARMRKLLAEQHSHWQKALLKALRESRMVLGSSNQRNWKINIYPFLRILRDEDY
VNIMLQGLANLPPSGESLLFLAKELGNRIHNVYCIQQKSHSQIVAKLGNIYNSYVKLLGK
DTEPSIVLPREQWSTLEAEHTAGPSLLSDDTPWPHMLVIQLGSFLVDLLVRELKIPNNIL
NPAQENKLIPVLYHMYTFRSNRQIGFIKPHPILTQIQSEAMETKLTFDSYVMPMLCPPVP
WTSAKSGAYLLTPTKLMRSVEGAIQHQLLLEKCQDEELHAVLDSLSQLGNCAWRINKPLL
DIIISIFNDKGSEKLDVPPPISEAPEIPRFNPHDPAYSPAEKAHLKREATRAKKKVAEMH
SLRMDALYKLSIANHMRDEIFWFPHNMDFRGRTYPCPPYFNHLGSDVTRAILLFAEGKPL
GPKGLDWLKIHLVNLTGLKKRSSLAGRLEYANTIMDDILDSADNPLMGRKWWMNADEPWQ
TLACCMEIANASRSCDPTQFISHFPVHQDGSCNGLQHYAALGRDVIGATSVNLLPCEEPQ
DVYSGVAQQVEEFRARDAAKGMKIAQVLEGFISRKVVKQTVMTVVYGVTRYGGRLQIEKR
LKEIDDFPKEYIWDASHYLVHQVFSSLKEMFTGTREIQDWLTESARLIAKSGSTVEWVTP
LGLPIVQPYHRTRNHVLKSNIQFLSLQISHDVYERPDTVKQKNAFPPNFIHSLDSTHMML
TALNCYSAGLTFVSVHDCYWTHALTVDIMNKVCREQFVALHNQPILQDLSKFLLQKYCSA
PPGNTKTKKFLEYWKMSQLLGKVPETGDFDLQRVKESTYFFS
NT seq 3909 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttttaagactgtgtgcctttccgaaatacttgaacggtagattcatgtttgaa
agaagtgctcgatttacattaaatagcaaccactgtctaaactgcctcagactccggaat
aactgcgagagaggaacgagagctaacccatggacaacactacaccaaaggcactactcc
gctattccaaagaaggaagatgggaaaagacgagtgtgggaacagtctcatttgttggac
gttctcgaggctcggatgcagcagttgcagtctgacgttttacatgtcaaacatttgaag
gttgaatttgtcaaagtgccaaagggagaaaaaagagacgctccagtgaagagtcaaaag
acagatgcagaaactagtaaagctgttcagtccactaaaaaaggtaccagttcacataac
ccgccctccaaagcacacgcgagccgctggattgagaaactcaagctcgagaagtcaaac
aaaactaaaaagcagtcatctctgcagcagaaactccgtgacaaaataggaacagcagca
aaaagcagtaaaggaaatctgatggctcctggaacatccataaaaacaatctctattgcc
aaaaggtgcaaacaacccgaacctgagtccacaacggctccaatgcctcaatccaaacac
ttacaaccaaaggtgtctaaacgctgtacaagtgcaaccacaatgaaagcggatcctgaa
aaactttccagaactgcagagctggctgaagtcgaagagctcgaaggaatgattggtgag
tggagtccgaccaacgccgagaaactcctagaagataaagacgggaaccgttatggtgat
gcacagctaaacttgcgctgccacctggaggcgtgtgtttttacaggggatgtggagcga
gcacagcactccctgttctttcaccaccggcacctaagcaaacgtaaagcgctctctgtc
agcgcttacaacatcatgatgaggttgtgggccaagaagggatctgtgaatcacattggt
cgcttattcgctatggtggaagaggcaggcctgaagcccaacttggcgtcatactctgct
gcgctggagtgcatgggccgcaatcccgacacctcttcacgcaccattaacagatgtctg
cagcagatggctgaaagtggcctgcatttggacgacatgttcagacagtgtgtattcaga
caggatgagcgagacatggtgctgaaggccatccggaccgtacaactcgactacgagcca
cacaccccttctgaacagccacgctgctcattaccactggtggagaacttctatactgag
agggaagaaaccagctatcctaagctagactttagcgttgctgagctgcaggagcgcttc
aggcgtcagctggctatggaacaggccaataccatcaccatcgactctgtggaggccatt
aaacctgtcacggaacacatggccaggatgaggaagctgttagctgagcagcactctcac
tggcagaaagctctgctaaaggctctgcgagagagtcggatggttttaggcagcagcaac
cagaggaactggaagatcaacatctacccgtttctgcgcatcctccgtgatgaggattac
gtcaacatcatgctgcagggattggccaacctgccgccaagcggagaatctctgctattc
ctggctaaggaactgggcaacagaatccacaatgtgtactgcatacaacagaagagtcac
agccagatagtggcgaaactgggcaacatctacaactcgtacgtcaaactgctcggaaaa
gacacagagcccagcattgtgttgccacgggaacaatggagcactttggaggcagagcat
accgctggcccctccctcctgagtgatgacacgccctggccacacatgctggtcattcag
ctgggcagcttcctggtggatctgctggtgcgtgagctcaaaattccgaacaacatcttg
aaccctgcccaggagaacaagctcatccctgtgctctatcacatgtacacgttccgcagc
aatcgacagattggttttatcaagccacacccaatcctgacccaaatacagtcagaagcc
atggagaccaagctgacctttgactcatatgtgatgcccatgctgtgcccaccggtgcct
tggacatcagccaaaagtggggcttacttgctgacgcccaccaagctgatgcgctcagtg
gagggtgccatccagcaccaactgctgctggagaagtgccaggatgaggagctgcatgct
gtgctggactccctcagccagctgggcaactgtgcatggaggatcaacaagcctctgttg
gacatcatcatctccatctttaacgataagggcagtgagaagctggacgtgcctccaccc
atttctgaggcgccagaaatcccacgcttcaaccctcatgacccggcatactcgcctgcc
gagaaggcccacctgaagcgcgaggccacaagggccaagaagaaggtggctgagatgcac
agtctgcgcatggatgcgctctacaagctgtccattgccaaccacatgagggatgagatc
ttctggttccctcacaacatggatttccgagggcgtacttacccatgcccaccctacttt
aaccatctgggaagtgatgtaaccagagccatcttgctgtttgctgaggggaagccgttg
ggtcctaaaggcctagactggttaaagatccacctggtgaacctcacaggtctgaagaag
cggagttcgctggctgggagactggaatacgccaacaccatcatggatgacatcctggac
tctgcagacaacccgttaatggggaggaagtggtggatgaatgctgatgagccttggcag
actctggcatgctgcatggaaatagcaaatgcctccagatcatgtgaccccacacagttc
atctcccatttccctgtacatcaggatggctcctgtaatggcctccagcactatgctgca
ctgggtcgtgatgtgattggtgcaacatcggtaaacttactgccctgtgaagaaccgcag
gatgtgtacagtggtgtggctcagcaggtggaggagttccgggcccgagacgctgcaaag
ggcatgaagattgcacaggtgctggagggcttcatcagcaggaaggtggtgaagcaaacg
gtgatgacggtggtctatggggtcacgcgctatggtggccgactgcagattgaaaagcgt
ctcaaggagatcgatgacttccccaaggagtatatttgggatgcttcacactacctagtg
catcaggtcttcagcagcttgaaggaaatgttcaccgggaccagagaaatccaggactgg
ctgactgaaagtgctaggctaatcgcgaagtccggcagcacggtggagtgggtgacccct
cttggactgcccatcgtccaaccctaccaccgcaccaggaaccacgtgctcaagagcaac
attcagtttctgagtctccagataagccatgatgtctatgagaggccggacacagtaaag
caaaagaatgcatttcccccaaactttatccactctctggactccacacatatgatgctg
actgcactcaactgttacagtgctggtttgacgttcgtatcggtgcatgactgctactgg
acccacgctcttacagtcgacatcatgaacaaggtgtgtcgtgagcagtttgtggctctg
cacaatcagcccattcttcaggacctctccaagttcctgctgcaaaaatactgctcagca
ccaccaggcaacaccaagaccaagaagtttctggaatactggaagatgtcacagctgctg
gggaaggttccagaaacaggtgattttgatctgcaaagggtgaaagaatccacatatttc
ttcagttga

DBGET integrated database retrieval system