KEGG   Ictalurus punctatus (channel catfish): 108271897
Entry
108271897         CDS       T04658                                 

Gene name
rassf1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
ipu  Ictalurus punctatus (channel catfish)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 108271897
NCBI-ProteinID: XP_017335316
UniProt: A0A2D0RYR1
LinkDB
Position
11
AA seq 365 aa
MSLGELIELEELEERIELADSLPPRTPRLERVNALRISPGKFPELWNRVRIIRLLGDTLK
DPQLVEETGEGHDFHPCSHAQPTWCDLCGDFIWGVYKQSLRCANCRFTCHYRCRALIKLN
CNQSDASTTDQSSDVQDSIETDTNVDEVTESKKQELSHSEIQQKIKEYNAQINSNLFMSL
NKDGSYNGFIKVHLKLVRPVSVPPPRKGTTSQEPANGKRGGAVKRRTSFYLPKDTAKHLH
ISSRTRAQEVIQALLKKFTVIDNPAKFALFERTERHDQVYLRKLPDDECPLFLRLCAGPN
EKVLSLVLKENETGEVNWDAFSLPELQNFLRILKREEEEHVKQIMQRYAVAHDRIQQALV
STKPG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtcattgggggaattgattgagcttgaggagcttgaggagcgcattgagcttgctgat
tctttaccacctcggactcctcgcctagagagggtcaatgctttgagaataagcccagga
aaattcccggagctctggaaccgtgtgcgcattatcaggctcctgggagacaccctgaag
gacccacagttggttgaagagacaggagaagggcacgacttccatccctgtagccatgct
caacccacctggtgtgatctgtgtggagacttcatctggggggtgtacaaacaaagcctg
cgctgtgccaactgtaggttcacctgccattaccgctgtagagctctcattaaactgaac
tgtaatcagagtgacgcctctacaaccgatcaatccagtgatgtccaggacagcattgaa
actgacaccaatgtggatgaagtgactgagagcaagaaacaagagctgtcacattcagag
attcagcagaagataaaggagtacaatgctcagataaacagcaacctcttcatgtctttg
aacaaagatggctcctacaatggtttcatcaaagttcatctgaagctggtacggcctgtg
tctgttccacctccacgaaagggtactacatctcaggagccagccaatgggaagaggggg
ggagcagtgaaaagacgcacgtccttctacctcccaaaggacacagccaaacatctgcac
atcagctctcgaactcgtgcacaagaagtgattcaggccctcctgaagaaattcacagtt
attgacaatcctgcaaagtttgcactgtttgagcgcactgagcgccatgaccaagtgtac
ctaaggaagctgcctgatgatgagtgtccactgttcctgcgtttgtgtgctggtccgaac
gagaaggtcctgagtctggtactaaaggagaatgagactggagaggtcaattgggatgca
ttttctctgccggagctgcagaattttctgcgcattctgaagagagaggaggaggaacat
gtaaagcagatcatgcaacgctatgcagtcgctcatgatcgcatccagcaagctctggtc
agcaccaaacctggctga

DBGET integrated database retrieval system