KEGG   Ictalurus punctatus (channel catfish): 108272679Help
Entry
108272679         CDS       T04658                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1-A-like
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108272679
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ipu03036]
    108272679
Enzymes [BR:ipu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108272679
Chromosome and associated proteins [BR:ipu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108272679
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108272679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TUDOR_5 DUF5604 Pre-SET Tudor_4 MBD DUF4537
Motif
Other DBs
NCBI-GeneID: 108272679
NCBI-ProteinID: XP_017336758
UniProt: A0A2D0S1X4
LinkDB All DBs
Position
12
AA seq 1418 aa AA seqDB search
MSEEEDQSVNMTEDELQHWVREQVEKDEQLVQRKAQLAQVDDWVKQKEREAKYTQLLYNN
ACESVRECESVMKGLYGMLGLEYRDTDSEEEGGAKPTENIRQITDDFDNGKDEHGADGEG
DDDYVVIDLGAVKEEPKEVELSAGIESSEFSVQMLAQKVKKTEAVDPPTEVNPPSPSTTR
KNKPSDTTLPTIKTLGSPTPITAPSLCDLPAQSLTPTKESSPPVSLGTSIPMSEPVETPP
LTTIPVTSSKSKNDIETPSETSVSTRQNAETSAQCVASTPTSTLPVKAVAASKCSKAASV
NQKPASKNKSSKATITSDTAGKTTAKEKVHDKWASPKPSSKPSSTTTPSNTTVKTAPAEK
AKAIDPKQGDKPETKAPTSSPHSGTTDTPTSDKTSKKTTSTNPPDGKEVSQTSSVTSVNP
VTPVTPVMPARLQKEVKLKVTMSVLGRRRTKTWHQGTILDIKTTESGPRYKILFDGGKGK
SVLSAHHLACVGPPMLKDLFVGCRVVACYREDKQSWLHAAVVVEMPERRNRMRFLVFFDD
GRPAYISLPDLHLVCKPMNNMSEDIEDKVWRAEVEEYLQAYPNPIFVVMRVGQDSKVERD
GKMEQCTVSQVDSSLIQICYKKDQEKEWLYKGSNRLDQIQRIKKRMAEKKKEQAVNKAEW
ISSQKNTKLPTTTATSTTTTTATSTTTTTPTSKTATSTTTPTPTSKTTTSTIKTTTAPTT
TASTATSSTTVNINIEPLKTSTTPGVSQTVSPVTTSSSMIKTFAGKPISQPRVVLNRITL
PLPLTTVKTTAHTEPTVAGSSNTGNKRPPSEEEEDSRLQNALLPVVEPGLKYVPHRCCPA
CLNPVRPMQRDKHRGQNPLLIPLLHGFRRMTARKRLDGKMSFHVFYRAPCGRSMCEMEEV
QAFLFESRCDFLFLDMFCLDPFVLVKRALLPSSMASRPLLFLPDISGGKEVVPVPCVNEL
NTVSPPPLSYTSHRLPAPGVFINTDLDFMVGCDCTDGCRDRSKCACYQMTIEATSLFTGG
PVDVTAGYTHKRLPRYVPTGVYECNALCRCDPWLCGNRLVQHGLQLRLEVFMTQHKGWGL
RCLDDMSKGTFVCVFTGKVVKDEVGNADSAMTGNEYLANLDYIEGVEKLKQGYESEAYCS
DTQEDSNKKTLVTMTTGALKKHGVFQMDSSSGEEKEETSQQKMERKTPGKRERKASDDLE
EYDEEDDDEDEDYKISANDGMGAEWKYLSADCKRSYTTRRNTKIPDKFQNNIQTSPKISE
EQNEVTSSVAKKMRKEGPGGRKLGFAKKSTRAFAVKSSHRRVKPQAVPEKCVQEKNTALD
RKCTRSLFNGEKTCYLIDAKQEGNLARYINHSCSPNLFVQNVFVDTHDLRFPWVAFFTSK
RIRAGTELTWDYSYEVGSVEGKVLLCCCGSAECTGRLL
NT seq 4257 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaggaggaccagagtgtgaacatgacggaggacgagctgcagcactgggtg
cgggagcaggtggagaaggatgagcagctggtgcagaggaaggcgcagttggcgcaggtg
gacgactgggtgaagcagaaagagagggaggcaaagtacacccagctgctgtacaataac
gcctgcgaatcagtccgtgagtgtgagtctgtgatgaagggcttgtatggcatgctggga
ctggagtatcgagacacagactctgaggaagaaggaggagccaaaccgacggaaaacatc
agacagatcacagatgattttgacaacggaaaagatgagcatggtgctgatggtgaaggc
gatgatgactatgttgtcatcgatttgggggcagtgaaggaggaaccgaaggaagttgag
ttgtcagcaggcatagagtcttcagaattttctgtgcagatgttagctcagaaggtgaaa
aaaactgaggctgttgaccctccaaccgaagtcaatccaccatcgccatcaacgaccagg
aaaaacaaaccttctgacaccaccttaccaaccataaagactttaggaagccccacacca
attactgctccatcgctctgtgatttgcctgctcagtcattaacgcctacaaaagaaagc
tctcctcctgtttcattaggcacatctatacccatgagtgagcctgtcgaaacccctcca
ttgaccaccattccagtcacatcttccaaatccaagaacgatatagaaacgcccagtgaa
acatcggtgtctacgaggcagaatgctgaaacttcagcacaatgtgtggcatctacccca
acatccacactcccagtgaaagctgttgctgcgtccaaatgttcaaaagcagcctcagtc
aatcaaaaacctgcctctaagaacaaaagctccaaagcaactataacctcggacaccgcc
ggtaaaaccacagccaaggagaaggttcatgataagtgggccagtcccaaacccagcagc
aaaccttcaagcaccacaacaccatccaataccacagttaaaactgcacctgcagaaaaa
gccaaggctatcgaccctaaacaaggtgacaaaccggagactaaagcccctacctccagc
cctcactctggtaccacagacacaccaacttcagacaagacttccaaaaaaacaacttct
accaatccaccagatggtaaagaagtctcccagacatcatcagtcacttcggtcaatcca
gtcactccggtcacacctgtgatgcctgctcgtcttcagaaagaggtgaagctgaaggtc
accatgagtgttcttggaaggcggaggactaaaacatggcaccagggcacaattttagac
atcaaaacaactgagtctggtcctaggtataagatcctgtttgatggtggtaaagggaag
agtgttttgtctgctcatcacttggcgtgtgttggccctcctatgctgaaggatctcttt
gtggggtgtcgagttgtagcctgctacagagaagacaaacagtcttggctccatgctgca
gtggtagtagagatgccggagcgcaggaaccgtatgaggttcttggtgttttttgatgat
ggccgtccagcctacatctccctgccagacctccatctggtctgtaagccaatgaacaac
atgtctgaagacatagaagacaaggtgtggcgtgccgaggtcgaggaatacctgcaggcg
tatccaaaccccatctttgtggtgatgcgggtggggcaggatagcaaggtggaacgtgat
ggcaaaatggaacaatgtaccgtcagtcaggtggatagcagcttgatccagatttgttac
aagaaagatcaggagaaagagtggctgtataagggctcgaatcgattggaccaaatccaa
aggatcaagaagcgaatggctgaaaagaagaaggaacaggctgtaaataaagcagaatgg
atttcatcgcagaagaacactaaactacccaccaccaccgccacaagtacaaccaccacc
accgccacaagtacaaccaccaccacccccacaagtaaaaccgccacaagtacaaccacc
cccacccctacaagtaaaaccaccacctccacaatcaaaaccaccaccgcccccaccacc
accgcctccactgctacctcttcaacaacagtaaatataaatattgaacccttaaaaacc
tctactactccaggtgtttctcagactgtttccccagtcacaacgtcctcaagtatgata
aagacatttgccggtaaaccaatatcacagcctagggtcgtcctgaacaggattaccttg
cctttgccgctgacgactgtgaaaaccaccgcacacactgagcccacagtggccggttca
tctaacacaggaaataaacgccccccttcggaagaggaggaggacagcagattgcagaat
gctcttctcccagttgttgagccaggactgaagtacgtacctcatcgctgctgcccggct
tgtctgaatcccgtgaggccgatgcaaagggataaacaccgtggccagaatccactactt
atcccgctgctccatggctttcgccgcatgaccgcaagaaagcgtctagatgggaagatg
tcttttcacgtcttctatcgtgctccgtgtgggcggagcatgtgcgagatggaagaggtg
caggccttcctgtttgagtcacgttgtgatttcctcttcctggacatgttctgcttggac
ccgtttgtgctggtgaaaagggctttgctcccgtcttccatggccagtcgtcctcttctg
ttcctgccggacatttcaggaggaaaagaggtggtgcctgtgccctgtgttaacgagctt
aacactgtctctccgccccctctgagctataccagccataggctgcctgctcctggtgtc
tttatcaacactgaccttgacttcatggtgggctgtgactgtactgatggctgtcgagac
aggtcaaagtgtgcctgttaccagatgaccatcgaggccacgtcattgttcaccggtggt
cctgtggatgtcaccgccggatacacacacaagcgattgcccagatacgtgcccactggg
gtgtacgagtgtaacgctctgtgtcgctgtgatccgtggttgtgcggtaacagactggtt
cagcacggccttcagctgcgcctggaggttttcatgactcagcacaaaggctggggcctg
cgctgcctggacgatatgtccaagggtacattcgtgtgtgttttcacaggtaaagtagtc
aaggacgaggtggggaatgcagacagtgctatgactggcaacgagtatttggcaaacctg
gactatattgaaggtgtggagaaactgaagcagggttatgaaagtgaagcttactgctct
gacacacaggaagacagcaacaagaagactcttgtaacaatgacgacaggagcgctaaag
aaacatggcgtgttccaaatggattcaagcagtggggaagaaaaggaagaaacaagccaa
cagaagatggaaagaaagacccccggtaaaagggagagaaaagcaagtgatgatttggaa
gaatacgacgaagaagacgatgatgaagacgaggactataagatcagcgcgaatgacggt
atgggagcggagtggaaatacctgagcgctgactgtaagaggagctacaccactcggaga
aataccaagatcccagacaaatttcagaataacatccagacatctcctaaaatctcagag
gagcagaatgaggtgacctcttccgtggccaagaagatgagaaaagagggtccaggaggg
cgtaagctgggatttgccaagaagtctacacgtgctttcgctgtcaagtccagtcatagg
agagtgaagccacaagcagtgcctgagaaatgtgtgcaagagaagaacacggcacttgac
aggaagtgcacgcgaagcctgtttaacggagaaaagacttgctatctcatcgacgctaaa
caggagggaaacctcgcacgatacattaaccatagctgcagtcccaatttgttcgtccaa
aatgttttcgtcgacacgcatgacctccgcttcccctgggttgcgttcttcaccagcaaa
cgtatcagggctggaacggagctgacctgggattacagctatgaggtgggcagtgtggaa
ggaaaggtactactctgctgttgtggttcggccgaatgcacgggccggttactctga

DBGET integrated database retrieval system