KEGG   Ictalurus punctatus (channel catfish): 108272761Help
Entry
108272761         CDS       T04658                                 

Gene name
sdha
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00020  Citrate cycle (TCA cycle)
ipu00190  Oxidative phosphorylation
ipu01100  Metabolic pathways
ipu01200  Carbon metabolism
Module
ipu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ipu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ipu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108272761 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    108272761 (sdha)
Enzymes [BR:ipu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     108272761 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 108272761
NCBI-ProteinID: XP_017336956
UniProt: A0A2D0S3E3
LinkDB All DBs
Position
12
AA seq 662 aa AA seqDB search
MAALFATSRVLGKKVLLSKALSPGSSASLRKLHFSIYGKRGDAKVSDAISTHYPVVDHEF
DAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDDWRWH
FYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTDDGKIYQRAFGGQSLKYGK
GGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEEGKCVGVIALCMEDG
SIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGNAMVTRAGLPCQDLEFVQFHPTGIYG
AGCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSMTIEIREGRGVGPEKD
HVYLQLHHLPPQQLASRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVI
TYKDGEDRVVPGLYACGEAGCASVHGANRLGANSLLDLVVFGRACALTIAETNTPGEKLE
PLKPNAGEESVANLDKLRFANGSTRTSEIRLNMQKTMQSHAAVFRTGEVLKEGCVKMDAI
YQSLDDIKTFDRGIVWNTDLVETLELQNLMLNAVQTIHSAEARKESRGAHAREDFKVRVD
EYDYSKPLQGQQKKPFEEHWRKHTLSYTDPKTGKVTLEYRPVIDDSLNAEDCAAIPPAIR
SY
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgttgtttgctacttcccgtgtcctcggaaaaaaggtcttgttatcaaaagcc
ttatccccaggttcctcagccagccttcgtaagcttcatttttccatttatgggaaacgg
ggagatgccaaagtctcagatgctatatccacacactatccagtggtggatcatgagttt
gatgctgttgtggtgggagcaggcggtgctggactgcgtgctgcttttggattgtcagaa
gctggttttaatacggcatgtgtcaccaagctgttccctactcgctctcacacagtggct
gcacagggtgggatcaatgcagcgcttggtaacatggaggaagatgattggcgctggcac
ttttatgacacagtaaaaggatctgattggctgggagaccaggatgccattcactatatg
actgaacaggctcctgctgctgtggttgagttggagaactttggtatgccattcagccgt
acagacgatggaaaaatctaccagcgtgcatttggaggccagagtctgaagtacggaaaa
ggaggccaggctcacaggtgctgctgtgtggccgacaggacgggtcactcccttctacac
acgctctacggacggtctctgaggtatgacacgagctattttgtggagtatttcgccctg
gacctgttgatggaggaaggaaaatgcgtcggagtcatagccttgtgcatggaagatggt
tctattcaccgtttcagggccaaaaacacagtaattgcgacaggtggttatggacgcacc
tatttcagctgcacatcagcacacactagtacaggagatggtaatgccatggtaacccgt
gccggcctgccatgccaggatctggagttcgttcagtttcaccccacaggcatctatgga
gctggttgtctgatcacagagggttgtcgtggtgaaggtggaatcctgattaacagtgaa
ggtgagagatttatggaacgctatgctccaaacgctaaagacttggcctccagggatgtg
gtttcacgctccatgaccatcgaaatccgtgagggaaggggtgtaggaccagagaaagac
catgtctacctccagctccaccacctcccacctcagcagctggcatcccgtctgccagga
atctctgaaaccgccatgatatttgctggagtggacgtcacgaaagaacctatcccagtc
ttacccacagtgcactacaacatgggaggcatccccaccaactacaagggacaggtcatc
acctacaaggatggtgaggatagggtagtgccagggttgtatgcctgcggtgaagctggc
tgtgcctctgtacatggtgccaatcgtctgggagccaactcactgctggatcttgtggtg
tttggccgcgcatgtgctctgaccattgccgaaaccaacactccaggggagaagcttgaa
cccctaaagcctaatgcaggagaggaatctgtcgctaacctggataaactacgctttgct
aatggctctacaagaacttctgagatcaggcttaacatgcagaagactatgcagtctcat
gcagcagtgtttcgtaccggagaggtcttgaaagaagggtgcgttaagatggacgccatc
tatcagtcattagatgacatcaagacatttgaccgaggtattgtttggaacactgaccta
gtggagactctggagctacagaatctgatgctgaatgctgtacaaacaattcactcagct
gaggctcgcaaagaaagcagaggggctcatgcccgggaagatttcaaagtgcgtgtggat
gagtatgactactcaaagccattgcagggtcaacagaagaagccttttgaagagcactgg
aggaaacacactctgtcatacacagatccaaagactggaaaggtcactctggaatataga
cctgtgatcgatgactctctgaacgctgaagactgtgccgccattccacctgctatccgc
tcctattaa

DBGET integrated database retrieval system