KEGG   Ictalurus punctatus (channel catfish): 108273160Help
Entry
108273160         CDS       T04658                                 

Gene name
gpd2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108273160 (gpd2)
Enzymes [BR:ipu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     108273160 (gpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_6 FAD_binding_2 EF-hand_8 FAD_oxidored GIDA Pyr_redox_2 EF-hand_5 Pyr_redox_3 Thi4 EF-hand_9 NAD_binding_8 SPARC_Ca_bdg HI0933_like
Motif
Other DBs
NCBI-GeneID: 108273160
NCBI-ProteinID: XP_017337701
UniProt: A0A2D0S5J2
LinkDB All DBs
Position
12
AA seq 729 aa AA seqDB search
MAFRKAVKGTLIGGGAIATAFGLSQFMEYRRNQPKWARLAYMEAEGKLKMPFEDRLPTRE
EQLAALQDTPEFDVLVVGGGATGSGCALDAVTRNLKTALVERSDFSSGTSSRSTKLIHGG
VRYLQKAIMKLDYEQYMMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWAGIK
MYDLVAGTQCLKSSYILSKSKALELFPMLKKDKLVGAIVYYDGQHNDSRMNLAIALTAAR
YGAAIANYTEVMQLLKATDPVTGKEKVCGARCRDVITGREFNVRAKCVINATGPFTDSLR
KMDNEKTANICQPSAGVHIVIPGYYSPDNMGLLDPATSDGRVIFFLPWEKMTIAGTTDTP
TDVTAHPIPMEEDINFILSEVRHYLSPDVEVRRGDVLAAWSGIRPLVTDPNSKDTQSICR
NHIVNISESGLVTIAGGKWTTYRSMAEETLDAAIKEHKLHAGPSRTVGLTLDGGKDWTPT
LYIRLVQDYGLENEVAQHLAATYGGRAFEVAKIAQVTGKRWPIVGKRLVSEFPYIESEVM
YAIKEYACTAIDMISRRTRLGFLNVQAADEALPRIVEIMAKELKWSEEKKKEQMEAAKQF
LYQEMGYKARSEQLTKTSEISLTHEQVARYKKRFYKFDKDSKGFITTLDVQQVLEKLSIQ
IDENALHEILNEVDLNKNGQVELDEFLQLMSAVQRGQISDSRLAILMRTVEEGLDSRGPV
SVDRSGGGV
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttcggaaagcagtgaaagggaccctgatagggggcggagccatagctacagcc
tttggcctatcacaattcatggaatacaggaggaatcagcctaaatgggctcggctggcg
tacatggaggcagaagggaagctgaagatgccgttcgaggacaggttgccgacacgtgag
gaacagctcgcagcgctgcaggacacgcccgaattcgacgtgttggtcgtggggggtgga
gctacgggatcaggatgcgctttagacgcagtcacgcgcaatctgaagacggccctggtg
gagaggagcgacttctcatcaggcaccagcagcaggagcaccaagctgatccacggagga
gtgcgttatctgcagaaggccatcatgaagctagattatgaacagtacatgatggtgaaa
gaggcactacatgagcgtgctaaccttctggaaatcgctcctcacctgtccgctccacta
cccatcatgctccctgtttacaagtggtggcagctgccgtattactgggccggtataaag
atgtatgacctggtggctggaactcagtgcctgaagagcagctacatcctgagcaagagc
aaagccctggagcttttccccatgctgaagaaggacaagctggtcggcgccatcgtctac
tacgatggccagcacaacgattcccgcatgaatttagctatcgctctgacggcggctcgc
tacggcgccgctatcgctaactacacagaggtgatgcagctgctgaaggctacagacccg
gtcacagggaaagagaaagtgtgcggagcgcgctgccgagacgtgatcacgggccgggag
tttaacgtgcgtgccaagtgcgtcatcaatgccacgggccccttcaccgactcgctgcgc
aaaatggacaacgagaagacggccaacatctgccagccgagcgccggagtgcacatcgtc
atccccggatactacagcccggacaacatggggcttttggatcctgccaccagcgatggg
cgtgtcatcttcttcctgccctgggagaaaatgactatcgccgggacaacagacacaccc
accgacgtgacagcccatcccatccccatggaggaggacatcaacttcatcctgagcgag
gtccgacattacctcagccctgacgtggaagtgcggagaggagatgtcctggcagcctgg
agcggcatccgtccactagtcactgaccccaactctaaagacacccagtccatctgccgc
aaccacatcgtcaacatcagtgagagcggcctggtcaccatcgccggtggcaagtggacc
acctatcgctcgatggctgaggagaccctggacgctgcgataaaggaacacaagcttcac
gccggaccgagcagaaccgtgggtctgacgctggatggagggaaggactggaccccaacc
ctctacatcagactggtccaggactacggtctggagaacgaggttgcccagcacctcgca
gctacctacggagggagggcgtttgaagtcgccaagatagcgcaggtcacaggaaagaga
tggcccatagtgggaaagcggctcgtatcagaattcccttacatcgagagtgaggtgatg
tacgctattaaagagtacgcatgcacagcgattgatatgatctctcggaggacgcggctg
ggtttcctgaatgtccaggctgctgatgaagctcttccacgcatcgtcgagatcatggcc
aaggagctgaagtggagcgaggagaagaagaaagagcaaatggaggctgctaaacagttc
ctgtaccaggagatgggctataaagctcgctccgaacagctcaccaagacgtccgagatc
tcactcacgcacgagcaggtggccagatataagaagcgtttctacaaatttgacaaagat
agcaaaggcttcatcacaacattggatgtgcagcaagtcctagagaaactgagcattcag
atcgacgagaacgccctgcacgagatcctcaacgaggtcgatctgaacaagaacggacag
gtggaactggacgagtttctgcagctcatgagtgccgttcagaggggacaaatctcagac
agccgattggccatcctgatgaggacagtggaggaagggttggactccagaggaccggtg
tcggtggaccgcagtggtggaggagtgtga

DBGET integrated database retrieval system