KEGG   Ictalurus punctatus (channel catfish): 108274800
Entry
108274800         CDS       T04658                                 

Gene name
atf6b
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04141  Protein processing in endoplasmic reticulum
ipu04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108274800 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108274800 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ipu03000]
    108274800 (atf6b)
Transcription factors [BR:ipu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    108274800 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf MCU TSC22
Other DBs
NCBI-GeneID: 108274800
NCBI-ProteinID: XP_017340671
UniProt: A0A2D0SDX7
LinkDB
Position
14
AA seq 665 aa
MTAELLSDLDSRFFADNLLTSEDWDACLYQCESMEEGEDRLKYDTLLHNDLVLTLDPDNP
MAPWKHLENKLLEGDMSVMKDEMAIAQPLPVDMCELFQVKAEPPSPSSSPTSDSSVLSLP
EAQFQVKGENPPTPPYMYGDVLSPPVGALEVTVATTAPPPHQAPPTLPVPTVAQTTVNAG
SILSSKPVLQPRPMCVAAKTLILQGTQPVVLSPSVCLGSAPAIVKMEPVSPSMHCTSPTA
PPTTKPIIPASSLPGSNCSDIDMKVLKRQQRMIKNRESACQSRKKKKEYVQNLEAQLREA
QQENERLRRENHALRIRLASKEVAESGTNKRAVCAMVLLLFITFSFAPVSITDRKFPSAL
EDGEELHTGRRLLVYETAQEPGRVVSDRPAEDRLDSEEDTGEDRWRRGAVERDNADSFYF
RNVSSEFSEVKDLVLQDIDQLFSSSDCRQFNRSESLRVADELRGWVRRHQINRKKTNRKP
KIAQKAKKAQQKAQFRKTNFSRYLPIETHRSIERWESQLQLLPGPEVSYSHFLDAIDRRE
DTFYVVSFRRDHLLLPAISHNKTTRPKMSLVMPAMAINESVYKSSQGGYELMMQVDCEVM
DTRIIPIKSSVVPPSLRNKPQNPPSHHHSQGNNTRPPHGSGASASKQPLPVRRRGAEFLI
TQSGS
NT seq 1998 nt   +upstreamnt  +downstreamnt
atgacggcggaattactgtctgatttggacagtcggttttttgcggataatctcctgaca
agtgaagactgggatgcctgtctgtatcagtgtgagagtatggaggagggtgaagacaga
ctgaaatatgacacactgcttcacaatgacctcgtgctgacccttgacccagacaacccc
atggcaccatggaaacacctggagaacaaactgctcgaaggtgacatgtctgttatgaaa
gacgagatggcgatagcacagcctctgcccgtggacatgtgtgagttgttccaagtcaag
gcagagcctccatctccttcgtcctctccgacctcagacagctctgtactgtccttacct
gaagctcagtttcaggtgaaaggtgagaaccctcccacgcccccctacatgtatggagat
gttctctcacccccggtgggtgccttggaggttactgtggcaaccacagccccgccccct
caccaagctccacccacacttcctgttcccacagtagcacagaccacagtgaacgctggc
tccattctgagcagtaagcctgtgctacagccgaggccgatgtgtgtggctgctaaaact
ctgatcctgcagggaacacaaccagtggttctgtccccgtcggtgtgtttgggctctgct
ccggccatcgtgaaaatggagcccgtgtctcccagcatgcactgcaccagccctacagcc
ccgcctaccaccaagcccatcatcccagcatcttctctgcctggcagcaactgcagcgac
attgatatgaaggtactgaagcgtcagcagaggatgataaagaaccgtgagtctgcgtgt
cagagcaggaagaagaagaaggagtacgtacagaacctggaggctcagctgagagaggca
cagcaggagaacgaacgtctgcgccgagagaaccacgccctgcgaatcagactcgccagc
aaagaggttgctgaatcaggcaccaataagcgagcggtgtgtgcgatggtgctgctgctc
ttcatcaccttcagcttcgcacctgtcagcatcacggacaggaagttcccgtctgcgctg
gaggatggggaggagcttcatacggggagacgcctgctggtgtacgagaccgctcaggag
ccgggccgggtggtgagcgacagaccggcggaggacaggctggacagtgaggaggacacg
ggagaggacaggtggaggagaggagcggtggagagggataacgccgattccttttacttc
aggaacgtgagcagtgagttcagcgaggtgaaggatctcgtcttacaggacatcgaccag
ctcttctcctcctccgactgcagacagttcaatcgctccgagtcactcagggtggctgat
gagctgcgtggttgggttcgtcgccatcagatcaacaggaagaagacaaaccgcaaaccc
aagatcgcacagaaggcaaaaaaagcacagcagaaagctcaattcaggaagacaaacttc
tcacgctacctccccatcgagactcaccgctccatcgagaggtgggagagtcagctgcag
cttttacccggccctgaggtgagctacagccacttcctggatgccatagatcggcgtgaa
gacacgttttatgtcgtctccttcagacgggatcatctgctccttcctgcgatcagtcac
aacaaaaccacacgacccaagatgtccctcgtcatgcctgccatggccatcaacgagtcg
gtgtataaatcctctcagggtggatacgagctgatgatgcaggtggactgtgaagtcatg
gacaccagaataatcccaatcaaatcctccgtggtcccgccctctctcagaaacaagccc
caaaacccgccttcgcaccaccatagccaaggcaacaacacccggccaccgcatgggagt
ggggcttcggcaagcaagcagcccctgcctgtcaggaggaggggggcggagtttctgatc
acacagtcgggatcgtaa

DBGET integrated database retrieval system