KEGG   Ictalurus punctatus (channel catfish): 108274807
Entry
108274807         CDS       T04658                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
ipu04060  Cytokine-cytokine receptor interaction
ipu04068  FoxO signaling pathway
ipu04144  Endocytosis
ipu04218  Cellular senescence
ipu04350  TGF-beta signaling pathway
ipu04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108274807
   04350 TGF-beta signaling pathway
    108274807
   04068 FoxO signaling pathway
    108274807
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108274807
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108274807
  09143 Cell growth and death
   04218 Cellular senescence
    108274807
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    108274807
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ipu01001]
    108274807
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108274807
Protein kinases [BR:ipu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   108274807
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 108274807
NCBI-ProteinID: XP_017340685
UniProt: A0A2D0SEL5
LinkDB
Position
14
AA seq 543 aa
MERLGVSVLSCVLLLFSTSFFTGLHASPISRTPFVLSKLCKFCDVRLSECNTTQGHCMVN
CNITSICERSDEVCASAWRRDGENITVETVCHDPSEPFHGVILKDFNNKECVMKQYAHLG
PDFYICSCQEEECNEKLIFSSAETSLRNPPVLTIVLVPVSVLAVMLLSLIYFCYVHTLRQ
SKLKHDFSDTHSILTTKHERSDSISNWLNHNTELLPVHLDEMVGKGRFAEVHRARLGQKT
SENGVFQTVAVKIFPLEEFVSWNTEREIFLDAELCHENIVHFLAAEKHTVEQRLWLITAY
HARGNLRDYLRAHRLEWTELCKMGGDVVRGLAHLHSDRNAVGGVKVPVAHRDLKSDNVLV
KDDRSCCICDFGLSIRLHNNMSTEELANRGQVGTARYMAPELLESRLNLENIESFKQADV
YSMALVLWEITSRCTAIGELREYEPPFGKLNQPCIESMKDTVIRDRERPEILLGWRTHPG
VNVLCEMIEECWDEDPEARLTASCVSERFNNFSDPSFLYTDLINEDKTSNLPETEAELLN
LSS
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggagcgactcggtgtatctgtgttgagctgcgtgctgctgcttttctccacttccttt
tttacaggccttcacgcgagccccatctctcggactccattcgttctaagcaaactatgt
aagttttgtgatgtcaggctaagtgagtgtaacaccactcagggccactgcatggtcaac
tgcaatatcacttccatctgcgagcgcagtgatgaggtctgcgctagtgcatggcgcaga
gatggtgagaacatcaccgtggaaaccgtgtgtcatgacccatcggagccgtttcacggt
gtgatcctgaaagacttcaataacaaggagtgtgtgatgaagcagtacgcacacctcggg
cctgacttctacatctgctcctgccaagaggaagagtgtaatgaaaagctcattttctcc
tcagcagagacatcactgagaaaccccccagtgttgaccatcgtccttgttcctgtctcg
gttctggccgtcatgctcctctcattgatttacttctgctatgttcacacactccgtcag
tccaaactgaagcacgattttagtgacacacattctatcctcaccaccaaacacgaacgt
tctgacagcatctcaaactggctcaatcacaacacggagcttctgcccgtccatctggat
gaaatggtggggaaaggacgtttcgctgaagtgcaccgcgcccgactcgggcaaaagacg
agtgaaaacggggtgttccagacggtcgcagtgaaaatcttcccactagaggagttcgtg
tcctggaacacggagcgcgagatcttcctggacgcagagctctgtcacgagaacatcgtc
cacttcctggcggcagagaaacacacagtggagcaacggttgtggctgatcacagcctat
cacgctcgaggaaaccttcgagactacctcagagcccaccgactcgagtggacagagctc
tgcaagatgggtggtgatgtcgtaaggggtctggctcacctgcacagtgaccggaatgca
gtgggtggagtcaaagtgccggtcgctcaccgagacttgaagagtgacaacgtgctggtg
aaggacgaccggagctgctgcatctgtgactttggcctcagcatccgactccacaacaac
atgagcacggaggagctcgctaacaggggacaggtgggcacggcgaggtacatggccccc
gagctgctggagtccagactgaacctggagaacattgagtccttcaaacaggcagacgtt
tactccatggctctggtgctgtgggagatcacgtccaggtgcacagccatcggagagctg
agagagtacgagccacctttcggaaagttgaatcagccgtgtattgagagcatgaaggac
accgtgatcagagaccgagagcgacctgagatcctgcttggctggaggacacacccgggt
gtgaatgtgctgtgtgagatgatcgaggaatgctgggatgaggatccggaggctcgcctg
acagcttcgtgtgtatccgagagatttaacaacttcagtgatccgtcattcctctacacc
gacttgatcaacgaggataaaacaagcaacctcccggagacagaggcggagcttttaaat
ttaagctcatga

DBGET integrated database retrieval system