KEGG   Ictalurus punctatus (channel catfish): 108275050
Entry
108275050         CDS       T04658                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108275050
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ipu03000]
    108275050
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ipu03310]
    108275050
Transcription factors [BR:ipu03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    108275050
Nuclear receptors [BR:ipu03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   108275050
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 108275050
NCBI-ProteinID: XP_017341094
UniProt: A0A2D0SEE8
LinkDB
Position
14
AA seq 757 aa
MEQGGVKNGAKRDEHLMTRSFSESPAEGVLQNGARDTMSFAPTTVVPPVSPLLQPVTGDL
PNGVNNTPSPEDITINLPSPLELFVEDPDLKMVGKDLRSQQSFQQQSSLELYSLGDNFSR
LEASIADLNSSLTSVDSLIGGGDPTLFPLKNEDFSPMGKGEMDLDQDPFGKDVDGSNPKL
FGENTMDLLEEFDLPESPTDLYLGDDEFPPIADDALLGVMVSDKDSKSVDSLSTSTIANV
NGGASSTPSSVSTSSPVLVIKQEKEPMIQLCTPGVIKQENASGRSFCQMTADLPSPVRNV
SIAICGVSTSSGQSYHFGSPVSSGSQQKDQKPVFNVYTPQPTGNEWGQGFGNASAMQQRA
SNSFTATQSFSTNYTGSTARPEANTATSSATGKASGTHKICLVCSDDASGCHYGVLTCGS
CKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLMAGMNLDARKSKKLKMKG
VQQTNTAEVTPPPAPEARSLVPKAMPQLVPTMLSLLKAIEPETIYAGYDSTVTDTSTRLM
TTLNRLGGRQFVSAVKWAKALPGFRNLHLDDQMTLLQSSWLFLMSFGLGWRSYQQCNGSM
LCFAPDLVINEERMKMPYMGDQCAQMLKISNEFGRLQVSNEEYLCMKVLLLLSTVPKDGL
KSQAVFDEIRMSYIKELGKAIVRREENSSQNWQRFYQLTKLLDSMHDMVGGLMNFCFYTF
VNKSLSVEFPEMLAEVISNQLPKIKAGSVKPLLFHQK
NT seq 2274 nt   +upstreamnt  +downstreamnt
atggagcagggaggcgtgaagaacggcgcgaagagagatgagcatttgatgacgcggagt
ttcagcgagagcccagctgagggagttttgcagaacggagcacgcgacaccatgtcattt
gccccgactactgtagtgcctcctgtcagccccctgttgcagcccgtgactggagatctc
cccaacggcgtgaacaacacgccctctccagaggatatcaccatcaatttaccatcccct
ctggagctctttgtggaggaccctgacctgaaaatggttgggaaggacttgaggtctcag
cagtcctttcagcagcagtcctcccttgagctctacagcttgggggataatttctcacgt
ctggaggccagcattgctgatctcaacagctccttaacgtccgtggactctttaatcgga
ggaggggaccctactctgttcccactgaaaaacgaggacttctcaccaatggggaaaggg
gaaatggatctagatcaagatcctttcgggaaagacgtggacggcagtaatccgaagctc
ttcggcgagaacaccatggacctcctggaagagttcgacttgcccgagtcgcccacagat
ctatacttgggagacgacgagttcccgccgatagcagacgacgctctgctaggagtcatg
gtttccgacaaggactccaagtctgtggactcgctgagcaccagcaccatcgccaacgtc
aacggcggcgccagctcgactccttccagtgtgtccacaagcagcccagtcttggtgatc
aagcaagagaaggagcccatgatccagctgtgcactccgggcgtgatcaagcaggagaac
gccagcgggaggagcttctgtcagatgaccgcagacctgccgagcccagtcaggaacgtt
tccattgccatctgtggcgtcagcacgtccagcggccagagctaccacttcggaagccct
gtatccagcggcagccagcagaaagatcagaaacctgtttttaacgtgtacacaccgcag
ccgacgggcaacgagtggggccagggattcggaaacgcaagtgcgatgcaacagagagcc
agcaacagcttcaccgccacccagagcttcagcaccaactacaccggctcgactgccagg
cccgaggccaacaccgccacatcctcggccacagggaaggccagcggcacacacaaaatc
tgcctggtgtgttcagatgatgcatcaggctgccactacggagttctcacctgcggcagc
tgcaaggtcttcttcaaaagagccgtggaagggcaacacaattatctgtgcgccgggcga
aacgactgcatcatcgacaaaatccgcaggaagaactgtcccgcgtgccgtttccgcaag
tgcctcatggccggcatgaacctggacgcacgtaaatccaagaagctgaagatgaaaggt
gtacagcagacgaacacggccgaggtaactcctcctccggcgcccgaggcgcgctcgctg
gtgcccaaagccatgccgcagctggtgcccaccatgctgtcactgctcaaagccatcgag
cccgagaccatttacgccggctacgacagcacagtcacagacacctccacgcggctcatg
accaccctgaacagactgggagggcgccagttcgtctccgctgtcaagtgggccaaagct
ctgcccggtttccgaaaccttcacctggatgatcagatgactctgctgcagtcctcctgg
ctcttcctcatgtcgttcggtttgggctggagatcttaccagcagtgtaacggcagcatg
ctgtgtttcgccccagacctggtgatcaatgaggagaggatgaaaatgccctacatggga
gaccagtgtgcccagatgctgaagatttccaatgagtttgggagactgcaggtgtcgaat
gaggagtacctgtgcatgaaggtgcttctgctgctcagcacagtgccaaaggacggtctg
aagagccaggctgtgttcgatgagatcaggatgtcgtacattaaagaactgggaaaagcc
atcgtgaggagggaagagaactccagccagaactggcaacgattctaccagctcactaag
ctactggactccatgcacgatatggtgggtggactgatgaacttctgcttctacacgttt
gtgaataagtctctgagcgtggagttccccgagatgctcgccgaggtcatcagcaaccaa
ctaccaaaaatcaaagccgggagcgtcaagccgctgctctttcaccagaaatga

DBGET integrated database retrieval system