KEGG   Ictalurus punctatus (channel catfish): 108275601Help
Entry
108275601         CDS       T04658                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K-like
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108275601
Enzymes [BR:ipu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108275601
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 108275601
NCBI-ProteinID: XP_017341995
UniProt: A0A2D0SI87
LinkDB All DBs
Position
15
AA seq 1489 aa AA seqDB search
MSRQSAYCCAGRFPERFCNVEEVFCNVLPPGVFPDGQLSVLSVELLKSKTGQNRLEHHTD
RYQSDDLIVRRGQSFQIWIELSRAFNPKSDHLQLLLKQGSVHRSRDIVVTVPLVNEFQGN
CWQAKIIEQNNRKIKLSVISPPTAPIGQYELSVITGASTFSSKPENYIYLLFNPWCEDDP
VFMDNKDERNEYVLNDVGIIYHGTENQIGFRTWNFGQFADGILAACLFILRKGQAPASGW
GDPITISRVVSAMVNTNDDQGVLTGKWSGDYADGVVPTTWSGSVHILKQYHKSGGVPVKY
GQCWVFSGVTTTILRCLGIPTRSVTNFSSAHDTDNSLTTDVYCDENLREIENLSKDSIWN
FHVWNECWMARPDLPPGMGGWQAVDATPQETSQGLYCCGPAPVAAIREGLVYLKYDAPFV
FAEVNSDRIFWQRQANGTFAPIFCEKSTVGHCISTKAVGSDRREDITHLYKYPEGSKEER
IAVETACRYGSKPNTYSCPVENDVTLNIALNEEEPQLGQDAHLSITVKNSSSKKRSIVLY
CQVAVMYYTGVRKGTVLKKEISVDVQPREVKALNLTLPYNQYKDQIVDQAALMLTVTGQV
SETKQVLATRFNFRLRTPDLIITPVGDAVVGREMTAKITFKNPLQCVLRNAALHIEGLGL
LSSEVIKIDVESLAVIALKVKFTPFLSGQRKLVASLDCQQLRQVHGVADILVKPKCMPGE
TMRNRVGRWPDVTLYDEESMNVDLVPEKNTENEEGKCRRWFRKICPCCCRQARKEPEDTG
IELNVGKEENGKKPPEETPETNENLLSVQSIDLIKSKKSENRVNHHTEHYHSDNLIVRRG
QTFQMWIELSRPFEPKTDKLHLELKLGPNPLVSKGTLVIVPLVDELQHNCWEAKIVEKKG
NKIKLSVNSMPTAPIGQYKLTVATQSPNGNSTSVYKPENDIYLLFNPWCEGDLVYLDDEE
ERKEYVLNDVGRIYYGTESQIGERTWNFGQFDDGVLAVCLFVLEKSQTPASGWGNPVNIT
RLVSAMVNSPDDQGVLEGNWSGNYADGTSPTAWSGSVDILKQYHKSGGMPVKYGQCWVFS
GVTTTVLRCLGIPTRSVTNFNSAHDTDVSLTNDVYLDENMEPIFELNGDSVWNFHVWNES
WMARPDLPAGMGGWQVVDATPQETSQGSFCCGPASVTAIRDGQVYLKYDAPFVFAEVNSD
KLYWQRNTDGTFSQIYCEKNAVGHCISTKAVGSNMREDITYQYKHPEGSEEERIAVETAT
RYGSKPNIYPSAVATDVTLEVTMKGEGPRMGEDAQLSISLKNDSSNMRNTILHSHVVVMY
YTGVQKAMIKKDDIVVELKPNEIHTLEWTLPYDLYKNELVDQAALMLTLSGRVSETNQVL
ATQFNFRLRTPDIIITLVGDAVVGKEMAAKLTFKNPLPQVLKKVKFRIEGLGLQKVREIS
YGDVGSLATITLTEKFIPTLPGQRKLLASLDCQQLTQVHGVADILVKDK
NT seq 4470 nt NT seq  +upstreamnt  +downstreamnt
atgagtagacaaagtgcttattgctgtgctggtcgcttcccagaaaggttctgcaatgtg
gaagaggtgttctgtaatgtgttacccccaggggtctttcctgatggtcagttatcagtg
ctctccgtagaacttcttaagtccaaaacaggtcaaaaccgtctggaacatcacacggac
cgctaccaaagtgatgacctcattgtccgtcgagggcagagctttcagatatggatcgag
ctctcacgagctttcaaccccaaatctgaccatctgcagctcctgcttaaacaaggctct
gtgcacaggtcaagagacattgtagtgactgtccctctagttaacgagtttcagggcaat
tgctggcaggccaagattatcgaacagaacaacaggaagataaaactgtctgtcatctcc
ccaccgactgctccaattggtcaatatgagctcagtgtgataacaggagccagcacgttc
agttccaagcctgaaaactatatctatctgctgtttaacccctggtgtgaagatgaccca
gtgtttatggataacaaggacgagaggaacgagtatgttctgaacgatgtggggattatc
taccacgggacggaaaatcagattggattcaggacgtggaactttggacagtttgctgat
gggattctggcagcatgtctgttcatattacggaagggtcaagcccctgcttctggttgg
ggagaccccattaccatcagcagagttgtgtcagccatggtcaacactaatgatgatcaa
ggtgtgttaactggtaaatggtcaggtgactatgcggacggcgttgttccaacgacatgg
agcggcagtgtgcacattctgaagcagtaccacaagagtggaggcgtgcctgtcaaatat
gggcagtgctgggtcttctcaggggtcaccactacaattctcaggtgtttaggcattcca
actcgcagtgtcacaaacttcagctccgcacacgacacggacaattccttgaccactgac
gtgtattgcgatgagaatctgcgagagattgagaatctcagcaaggattctatttggaat
tttcacgtgtggaatgaatgctggatggcccggcctgatctgccacccggcatgggcggc
tggcaggctgtggatgccacgcctcaagagacaagccagggactgtactgctgtggccct
gcacccgtagcagccattcgtgaaggactggtctatctcaaatatgatgcaccctttgtc
tttgctgaagtgaacagtgacaggatcttctggcagagacaagctaacggcacctttgct
ccgatcttctgtgagaagagcacagtgggtcactgcatcagcaccaaggcagtcggctct
gaccgcagggaggacatcacacacctctacaaatacccagaaggatctaaagaggagaga
atcgccgtggaaactgcttgccgctacggctccaaacccaacacctactcctgtcctgtt
gagaatgacgtcacattaaacattgccctgaatgaggaggaacctcagctaggtcaagat
gctcatctgtccatcactgtgaagaacagcagctctaagaagcgcagtatcgtcctctac
tgccaggtggcggtcatgtactacactggagtgcggaagggcactgtgttgaaaaaggaa
atatctgtggatgtccaaccccgtgaagttaaggcacttaatttgaccctgccttataac
cagtacaaggaccagattgtggaccaggcggcactgatgctcaccgtgactggacaagtc
agtgagaccaagcaggttctggccaccagattcaacttccgcctgaggacgcctgacctc
atcatcacccctgtaggagatgccgtagtggggagagagatgactgctaagatcacattt
aagaatccactacagtgtgtcctgaggaacgctgctttgcatatcgagggcttgggcttg
ctgtcctcagaagtgatcaaaattgacgtggagagtctggcagtcattgctctgaaggtg
aagttcacgcccttcttatccggtcagcgcaagcttgtcgcgtctctggactgtcagcag
ctcagacaggttcacggtgttgctgacatcctcgtcaagccgaagtgtatgcctggcgaa
accatgaggaatcgggtcggtcgctggccagatgttacactatacgatgaggaatcaatg
aatgtggatctggtgccagagaagaatacggagaacgaggaagggaagtgtcgaagatgg
tttcgcaaaatatgcccatgctgctgtcgtcaagccagaaaggaacctgaggacactggc
attgagctcaatgttgggaaagaggagaatggaaaaaagccaccagaagaaactcctgaa
acgaatgaaaatctgttatcagtgcagtccatagacctcatcaagtccaaaaaaagtgaa
aaccgtgtgaatcatcacacagagcattaccacagcgataacctcattgtccgccgaggg
cagacgtttcagatgtggatagagctctcacgacctttcgagcccaaaaccgacaaactg
cacctcgagctcaaacttggtcctaacccactggtatcaaagggcactctagtgatcgtt
ccgctagttgatgagttacagcacaattgctgggaagccaagattgttgagaagaaaggc
aacaaaatcaaactgtcagtcaactccatgccgactgcgcccattggccagtacaagctc
actgtcgcaactcaatctcccaatgggaatagcacttcagtatataaacctgaaaacgat
atctacctgctgttcaacccctggtgtgaaggtgacttggtgtatctggatgatgaggag
gaaaggaaagagtatgttctgaatgatgtgggaaggatctactatggtaccgagtctcag
attggagaaagaacctggaactttggacagtttgatgatggggttctggcagtttgtctg
tttgtactggagaagagtcaaacccctgcttctgggtggggaaaccctgttaacattacc
agactcgtgtcagccatggtcaactctcctgatgaccaaggtgtgctggaaggcaattgg
tctggcaactatgcagatgggacttccccaacagcatggagtggcagtgtggacattctg
aagcagtaccacaagagtggaggcatgcctgtcaaatacgggcagtgctgggtcttctca
ggggtcaccactacagttctcaggtgtttaggcatccccacccgcagtgtcacaaacttc
aactccgcccatgacacagacgtttccttgacaaatgacgtgtatttggacgagaacatg
gagccgatttttgagctcaatggcgattctgtctggaattttcacgtgtggaatgaatcc
tggatggctcggcctgatctgccggctggcatgggaggttggcaagtggtggatgccaca
cctcaagagacgagtcagggctcgttctgctgtggtcctgcctccgtgacggctatccgt
gatggacaggtctaccttaaatatgacgcacccttcgtctttgctgaggtgaacagtgat
aagctttactggcagaggaacactgatggcaccttctctcagatttactgtgagaagaat
gcggtgggccactgcatcagcaccaaggcagttggctctaacatgagagaagacatcacg
taccagtacaaacacccagaaggatctgaagaggagcgaattgcagtggaaactgccact
cgctacgggtcaaagcctaacatctacccctccgctgtggccacggacgtcacgttagag
gtcacaatgaaaggagaagggcctcggatgggagaagacgcacaactgtccatcagcttg
aagaatgacagctctaatatgcgcaacaccatcctccacagtcacgtggtagtcatgtac
tacactggagtgcagaaggctatgataaaaaaggatgacatagtggtggagctcaaaccc
aatgagatccatacactggaatggacccttccgtatgacctgtataagaatgagctggtg
gaccaagcagcactgatgctcaccctatctggccgagtcagtgagaccaaccaggttctg
gccacccagttcaacttccgcctgcgcacgcccgacattataatcacccttgtaggggat
gctgtagttggtaaagagatggcagctaaactaaccttcaaaaatccactaccacaagtc
ctgaaaaaggtgaagttccgcatcgagggcttgggcttgcagaaagtcagagagatctcc
tacggtgacgtgggcagtctggcgaccatcaccctgacggagaagtttattccaaccttg
cctggtcagaggaagctgctagcctctctggactgtcagcagctcacacaggttcacggc
gttgccgatatcttggtcaaggataagtga

DBGET integrated database retrieval system