KEGG   Ictalurus punctatus (channel catfish): 108275953
Entry
108275953         CDS       T04658                                 

Gene name
ikbkg
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
ipu04210  Apoptosis
ipu04620  Toll-like receptor signaling pathway
ipu04621  NOD-like receptor signaling pathway
ipu04622  RIG-I-like receptor signaling pathway
ipu04623  Cytosolic DNA-sensing pathway
ipu04625  C-type lectin receptor signaling pathway
ipu04920  Adipocytokine signaling pathway
ipu05132  Salmonella infection
ipu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108275953 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108275953 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108275953 (ikbkg)
   04621 NOD-like receptor signaling pathway
    108275953 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    108275953 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    108275953 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    108275953 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108275953 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108275953 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108275953 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ipu01001]
    108275953 (ikbkg)
Protein kinases [BR:ipu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   108275953 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 Cas_GSU0053
Other DBs
NCBI-GeneID: 108275953
NCBI-ProteinID: XP_017342619
UniProt: W5UL35
LinkDB
Position
15
AA seq 568 aa
MVQPQPYGDSAFQWDMAGEEAGGAASQGSLTTSSQGSLRVPPELPGHEVVNRLLLDNHQL
REALRRSNDALKNRCEEMEGWQRRSREEREFLSGRFHEARALVERLAQENKNLLSKLKPD
VSHVAPEGTALCSESACQNRNQESSRADINGLTEELNDLAVIERKVDAEQDTDRQAMPRS
LPNEGSNEILKILKSHKEKLEERMRVLKRRNEELEKEKMESKKENEGLLNTVDQLRFKLT
QLTQTDAVTEETLHKNPYTVSPERYRELQEKLNVLEQNTMQRDRIEPLLKQKEKDCIQLT
KDSEALRAQVTSLLGELKERQTSLDKCEDDKRRLEERLCCKTDSLQTLERDMEEQKKQHC
VTVDKFLLQTQNLEAALKKERAVIVEERRKLAQLQHAYTCLFQDYDSKLKNEKLANHRSG
ETETLTHRLEEAEKALALKQAHIDKLKEEVEQQRTLQETNEVLTAQAEIFKSDFLAERRA
REELNQKKEELQEKLNQTLTELNLLKQEKMQQRHMDSYRPAPAILPGPGIPQPNRNAPEM
QPEYQCPKCQYNAPDMDTLQIHVMDCIQ
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggtccagccccagccttacggggacagcgcctttcagtgggacatggcaggagaggag
gccgggggggctgccagccaaggctcactaacgactagttctcaaggatcattaagggtg
ccacctgaactacctggacatgaagtggtcaacagacttcttttggataaccaccagtta
cgagaggcactgaggaggagcaatgatgccctgaaaaacaggtgcgaagagatggaggga
tggcaacgaagatctagggaagagagagaatttctgagtggcaggtttcatgaggcacgg
gctttggttgagcgactggctcaggagaataagaatttgctgagcaaactcaaacctgac
gtcagtcatgtagcacctgaaggcaccgctctgtgctcagagtcagcatgtcaaaatcgg
aaccaagagagttctcgtgcagacattaacggactgacagaggaacttaatgacttagcc
gtgattgagcggaaggttgatgcagaacaagacactgacagacaggcaatgcctcgaagt
ttgcctaatgaaggttctaacgaaatcctaaagatactgaagagtcataaagagaagctc
gaggaaagaatgagagtgctgaagaggagaaatgaggaactggagaaggagaaaatggag
agtaaaaaagaaaatgaaggccttctgaatactgtggaccagctacgcttcaaactgaca
cagcttactcagactgatgctgtgacagaggagacattgcataaaaatccttataccgtc
tctccagaaaggtatagagagcttcaggagaaactgaatgtactagaacagaacacaatg
caaagggatagaattgagcctctactcaaacagaaggagaaggattgtattcagctgacc
aaggacagtgaggctctaagggctcaggtcacttctctacttggtgagctgaaagagcgc
cagacatccctagacaagtgtgaagatgataaaagacgtttagaagaaaggctgtgctgt
aagacagatagcctgcagaccctggagcgtgacatggaggagcaaaagaagcagcattgt
gtgaccgtggacaagttccttttgcagacacagaacctggaggcggcactgaagaaagaa
cgggctgtcattgtggaggagaggaggaagctagctcaactccagcacgcttacacctgt
ctcttccaggattatgactccaaactgaaaaatgaaaagttagccaatcacaggagtgga
gaaacagagacgcttactcatagactagaggaagctgagaaagctctggccttgaaacaa
gctcacatcgacaaactcaaagaagaagtggagcagcagaggaccttacaggagaccaat
gaagtgctcacagcacaggcggagatcttcaagtcagacttccttgcagagagacgagca
cgggaggagctcaaccaaaagaaggaggagctgcaggaaaaactgaaccaaacactgact
gaactcaatctcctcaagcaggagaagatgcagcaaagacacatggacagctacagacca
gcacctgcaatattgccaggccctgggataccacagccgaatcgcaatgcccccgagatg
cagcctgaataccaatgccctaagtgtcagtacaatgctccggacatggacaccctgcag
attcacgtcatggactgtatccagtga

DBGET integrated database retrieval system