KEGG   Ictalurus punctatus (channel catfish): 108277289Help
Entry
108277289         CDS       T04658                                 

Gene name
tmprss2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ipu01002]
    108277289 (tmprss2)
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     108277289 (tmprss2)
Peptidases [BR:ipu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108277289 (tmprss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 Trypsin_2 Ldl_recept_a SRCR DUF4448
Motif
Other DBs
NCBI-GeneID: 108277289
NCBI-ProteinID: XP_017345375
UniProt: A0A2D0SST7
LinkDB All DBs
Position
16
AA seq 478 aa AA seqDB search
MHNNPSHINYGFHYGEERPPVQAPGYPPPIYPTVPLYSNAAPAPINTHYTVTSGLPHTPA
GRKVSRNRCLCITAAVIFIFIILAVAAVLLWYFLAGACVTGRTCGRSSTCVRSSQWCDGR
ADCPAGEDEAQCFRLYGPNSILQSFSNEDQKWKVVCSDRWNDNTGKQACKEIGYSSSDYV
SYGTIDPGSSAGDGYMTLKSDYSNVLNSEPVHSSLSNSARCQTNTVVTLKCIDCGKSLAP
GTRIVGGEVVNNLGRWPWQVSLQARGSHTCGGSIITPSWIVTAAHCVQSLSSPSQWKVYA
GYLTLSQMKSAIGNSVMLIISHPGFDTDNNNDIALMKLWTPLQISSSIKPVCLPNTGLDL
STSRTYYVTGWGATRSQGSASNELREAQVSLISRTVCNSQQVYNGQITDTMICAGKLEGG
VDSCQGDSGGPLVTSENFLWWLVGDTSWGQGCAIQNRPGVYGNVTTLLDWIYTQMKKY
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcataacaacccctctcatataaactacggatttcattatggagaagaaagacctccc
gtacaagcgcctggatatccaccgccgatttatcccaccgtacctctgtactcgaacgca
gcacctgcacccatcaacacgcactacaccgtcacatcggggcttcctcataccccagcg
ggacgcaaagtcagcagaaatcgatgtctgtgcataacagcagcagttatcttcatcttc
atcatcctggcagtagcggccgtgttgctctggtacttcttagccggagcgtgcgtgacg
ggccggacgtgtggtcggagcagcacgtgtgtgcgctcgtcgcagtggtgtgatggacgg
gcggattgtccagcaggcgaggacgaggcccagtgctttcgtttatacggtcctaattcc
atcctgcagagtttttcaaacgaagaccagaaatggaaggtagtgtgttcagacaggtgg
aacgacaacactgggaagcaagcttgtaaggagatcggatattccagttctgactatgtt
agttatgggacaatagatccaggttccagcgcaggagacggctacatgaccctcaaatct
gattactcaaacgtactcaactctgagcctgtacatagctctctctcgaacagtgcgaga
tgccaaacgaacacagtggtgaccctgaagtgtatcgattgcggaaagtctctcgctccg
ggaacgcgcatcgtcggaggggaagtggtgaataacctgggacgctggccatggcaggtc
agtctgcaggccagggggagtcacacgtgtggaggatcgatcatcactccatcatggatc
gtcaccgctgctcactgcgttcagtcactttcatctccaagtcagtggaaggtgtacgcc
gggtatctgaccctgagccagatgaaatccgccatcggcaactcggtcatgctgatcatc
tctcaccccggctttgacaccgataacaataacgatattgctctgatgaaactgtggacg
ccactccaaatatcgtctagcattaaaccagtgtgcttgccgaacaccggtctcgacttg
tcaacatcaagaacatactatgttactggatggggggcgaccaggagtcaaggttctgcc
tctaacgagttacgtgaggctcaggtctcgctgattagcaggacggtgtgtaacagccag
caggtttataacggccaaatcacggacaccatgatctgcgcaggcaagctggagggtgga
gtggactcgtgccagggggacagcggtgggcctctggtcacttcggagaattttctgtgg
tggctggtgggagatactagctggggtcagggctgcgctattcaaaaccggccgggtgtt
tatggaaacgtgaccaccctcctcgactggatttacacgcaaatgaagaaatattaa

DBGET integrated database retrieval system