KEGG   Ictalurus punctatus (channel catfish): 108277418Help
Entry
108277418         CDS       T04658                                 

Gene name
wbscr17
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00512  Mucin type O-glycan biosynthesis
ipu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    108277418 (wbscr17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ipu01003]
    108277418 (wbscr17)
Enzymes [BR:ipu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     108277418 (wbscr17)
Glycosyltransferases [BR:ipu01003]
 O-Glycan biosynthesis
  Mucin-type
   108277418 (wbscr17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 108277418
NCBI-ProteinID: XP_017345645
UniProt: A0A2D0STK8
LinkDB All DBs
Position
17
AA seq 606 aa AA seqDB search
MIRFRLLLSLMAFMMRRWKVLVVLNVFVVAGFVTFWGKCDVRPNKIVNGHSRLNGSSSDP
SVSHEVLLKRLGSLEDVVYRQLNGLSKSLGLIEGFRGQGKGGFPSTLTPEEEKQAKYLQE
KYGYNAFLSDRISLDRSIPDYRPSKCKNMFYPRDLPQISLIFIFVNEALSVILRSVHSAV
NHTPPHLLKEIILVDDNSDDEQLKGPLEEYVNKRYPGLVKIVRNQKREGLIRARIEGWKM
ATGEVTGFFDAHVEFTPVWAEPVLSRIKQDPKRIILPSIDNIKHKSFGLERYENSGHGFN
WELWCMYISPPKQWWDEGDTSAPIRTPAMIGCSFVANRHYFGELGLLDSGMDVYGGENIE
LGIRVWMCGGSMEVLPCSRVAHVARTKKPYHSNIAFHTRRNALRVAEVWLDEYKSNVYLA
WNIPTVNHGIDYGDISERVALRKKLQCKNFEWYLDNIYPEMRRYNNTLFYGEIRNSNVTH
LCVDQGVKENHTATLHPCHGWNPQLGRYTKEGYLFVGPLGSTGDDTSCVIDDMISSFPQL
VNCDKVANIGQKTWNFVQNESIVNRATGRCLEVVKANVSFGYALVLQACTSQRWNIKNAM
RKQQGL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgatccgattcaggttgctgttgtccttaatggcgtttatgatgagaagatggaaggtg
ttggtggtgctgaacgtgttcgtggtagctggcttcgtcactttttggggaaagtgtgat
gtacggccgaacaaaattgttaacggtcactctcgcctcaacggatcttcttcggaccca
agcgtgagtcatgaggtcctgctgaagaggcttggctcattggaagatgtggtctacaga
cagctaaatggtttgtccaaatctcttgggcttattgagggcttcagaggccagggcaaa
ggtggctttccttccacactgacacctgaggaggaaaagcaagccaaatacctgcaggag
aagtacggctacaatgcattcctgagtgacaggatttctctggacaggtccatcccggac
tatcggcccagcaagtgcaaaaacatgttttatcccagagacctgccccagatctccctt
atattcatctttgtgaacgaggcgctgtcggtgatcctgcgatctgtgcactcggccgtc
aatcacactccacctcatctgctgaaggagatcatcctagtagacgataacagcgatgat
gagcaactgaaagggccacttgaagaatatgtcaacaaacggtatccaggccttgtcaaa
atcgtgcgcaatcagaagcgagagggcctcatccgtgctcgcatcgagggctggaaaatg
gccacaggggaggtgacaggctttttcgatgcccacgtagaattcactcctgtttgggct
gaaccagttctgtccagaattaagcaggaccccaagaggatcatcctaccttcaatagac
aacattaaacataaatcatttggcctggaacgctacgagaactcaggccatggtttcaac
tgggagctgtggtgcatgtacatcagtcctccaaaacaatggtgggatgagggagatacc
tcggcacccatcaggacgcctgcaatgataggctgttcattcgtggcaaaccggcactac
tttggagagttgggtctgctggactcgggcatggatgtctatggtggagaaaatatagag
cttggaattagggtttggatgtgtggaggaagtatggaggtcttgccatgctctcgggtg
gctcacgtcgccagaacgaagaagccgtaccacagcaacatcgcttttcacaccaggcgc
aatgcactgcgggtggctgaagtatggttggacgagtacaagtctaatgtctacctggct
tggaacattccaacagtgaaccatggcattgattatggggacatatcagagcgtgtggca
ctgaggaaaaaattgcagtgtaaaaactttgagtggtacctcgataatatctacccagag
atgaggcgatacaacaacactctgttttatggagaaattcgcaactccaacgtgacccat
ctgtgtgtggatcagggtgtgaaggagaaccacacagcaacccttcacccttgccacggt
tggaatccacagcttggacgctatactaaggagggatacctgtttgtgggacctttggga
agcactggagatgacaccagctgtgtgattgatgacatgatcagcagcttccctcagctt
gtcaactgcgacaaagtcgccaacataggccaaaagacatggaactttgtacagaatgaa
tcgattgtgaaccgggccacaggtcgctgcctagaggtggtaaaggccaacgtctccttc
ggctacgcgctggttctgcaggcctgcactagccagaggtggaacatcaaaaacgccatg
aggaagcaacagggactctga

DBGET integrated database retrieval system