KEGG   Ictalurus punctatus (channel catfish): 108277792Help
Entry
108277792         CDS       T04658                                 

Definition
(RefSeq) transmembrane protease serine 4-like
  KO
K09635  transmembrane protease serine 4 [EC:3.4.21.-]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ipu01002]
    108277792
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     108277792
Peptidases [BR:ipu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108277792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 SRCR Trypsin_2 DUF1986 Ldl_recept_a DUF5467 Hepsin-SRCR Biotin_carb_N ODV-E18 TMEMspv1-c74-12
Motif
Other DBs
NCBI-GeneID: 108277792
NCBI-ProteinID: XP_017346200
UniProt: A0A2D0SUL0
LinkDB All DBs
Position
17
AA seq 455 aa AA seqDB search
MRTADSTAEDSSTPLNSKQQGGARRGKHRKPMSATTPRGNNCASRKKLLITILCVVVILA
ILVVAGYLIAQLVQSKYFFCSKSLKFIPLEKACDGKADCEGGEDETSCISHFTSNTTFPV
RLATNLSVLQVYNATEKNWRSVCTDGWTVEHTTTACQQLGYTVNPKQKTVPLTDLSSDLK
TFFSAVGPDATKPISSSVLNQITCSSGSVVSLSCSDCGPLVQESRIVGGHNALIENWPWQ
VSLQQNGQHSCGGSVLSPKWIITAAHCFTGRAEVSRWRVVAGSTYMTSLGGYAVDKIIVN
GLYNKQLNDYDVAMMRLTKPLTIQATVKPVCLTPHDLGLKGRTSLVITGWGHLQENGHLS
SNLQKAEIEFIDSAQCSDIYGAGITSRMICAGFLQGKVDACQGDSGGPLVYQNDRWRLVG
VVSWGVGCARPGLPGVYSNVDPMLNWIYTVMAQMS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaggacggcagactcgacggctgaagacagctctactcccttaaactcaaaacagcaa
ggtggagccagacgtggcaagcacagaaagcccatgtcagccacaacgccacgagggaac
aactgtgcatcgaggaaaaagctcctcatcactatcctctgtgtagtggtcattttggcc
atcctggtagtggctggatatttaatcgcccaactcgttcaaagtaagtatttcttctgc
tccaagtcactgaagttcattcccctggagaaggcctgtgatggcaaagcggactgtgaa
ggaggagaggacgagacttcatgtatctcccatttcacaagcaacacaacgtttcccgtt
cggttggccacgaatctctccgtgcttcaggtatataatgccactgaaaaaaactggaga
agtgtgtgtacagatggctggactgtggaacacacgacaacagcatgtcagcagctggga
tacacagttaatcctaaacagaagacagtcccactgaccgatctgtcgtctgatctgaag
acgtttttttctgctgtgggaccagacgccacgaagccgatttcctccagcgtattaaat
caaataacatgcagttcaggttcagtagtttctttatcctgctcagactgtgggccattg
gtacaggagagcaggattgtaggagggcacaatgcactcattgagaactggccatggcag
gtgagcctgcagcagaacggccagcactcgtgtggaggctcggtgctgtctccaaaatgg
atcatcactgcagcccactgctttacaggcagggcagaggtaagcagatggcgggtggtg
gcaggcagtacatacatgacttcactagggggctatgctgtggataaaatcattgtgaat
ggattgtacaacaaacaactcaacgattatgacgtggcaatgatgagactcacaaaacca
ctcactattcaagccacggtgaaaccagtgtgtctcacacctcatgatctcggactcaaa
ggaagaacctcactggtgataactggctggggccatctgcaggaaaatggccatctgtca
tcaaatcttcagaaggccgaaattgagttcatagacagtgctcagtgttctgacatttat
ggtgctggcatcacttcgagaatgatttgtgcagggtttctgcagggcaaagtggacgca
tgccagggtgacagtggaggtcctctggtgtatcaaaatgaccgctggaggttggtagga
gtggtgagttggggtgtaggctgtgccagaccaggcctacctggtgtttactctaacgtg
gatccaatgctcaactggatctacacagtcatggcgcagatgtcctga

DBGET integrated database retrieval system