KEGG   Ictalurus punctatus (channel catfish): 108278375
Entry
108278375         CDS       T04658                                 

Gene name
nos2, NOS2b1
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00220  Arginine biosynthesis
ipu00330  Arginine and proline metabolism
ipu01100  Metabolic pathways
ipu04020  Calcium signaling pathway
ipu04146  Peroxisome
ipu04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    108278375 (nos2)
   00330 Arginine and proline metabolism
    108278375 (nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108278375 (nos2)
   04020 Calcium signaling pathway
    108278375 (nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108278375 (nos2)
Enzymes [BR:ipu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     108278375 (nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 108278375
NCBI-ProteinID: XP_017347206
UniProt: A0A2D0SXG4
LinkDB
Position
17
AA seq 1080 aa
MGKIIHDKMKELPVTQTKVKENRVSRCPMSAQMMKNFQNGSSHQDTLYHRAVKSQLCKPK
MCEGSIMNPKTLMRSSAVSPPSTNELLTQAIDFINQYYKSFKTLKIDEHLARVNEVANEI
DATGSYQLTPQELAFGAKQAWRNAPRCIGRIQWSNLQVFDARKCRTAKEMFQFMCSHIKF
ATNGGNLRSAITVFPQRTDDQHDFRVWNSQLIRYAGYQMEDGRIIGDPSNVEFTEICVQL
GWTPKYGSFDVLPLILQANGEDPELFEIPPELVLEVEMEHPQHKWFKDLNLRWYALPAVS
NMLLEIGGLEFTACPFNGWYMGTEIGVRDFCDTQRYNILEKVGRCMGLDTHNLSSLWKDE
ALVAINVAVIHSFQKNKVTITDHHSAAESFMKHMETELRLRGGCPADWVWLVPPMSGSLT
PVFHQEMISYILSPFYYYQPDPWSTYVWKDQTKGLKKRKRISFNALAKAMVFSQILMQSA
LKKRVPCTILYATETGKSQTFAIKLKSMLSCAFNPRLLCMEDYNCQDLKKERLMMVVTST
FGNGDPPGNGESFQKQLMNLKKLQNNMRYGVFGLGSRMYPQFCAFAHAVDDKLAELGGKR
VAPMGEGDEINGQEEAFSAWACNVFKAACEEFGVKGQLSGSERGLTETWDALRHRVQPDS
STLDCISALSALHSKTVFPMKLKKRKNLQSKESSRSTLLVELEVDCGREVLNYAAGDHVG
VFPGNSHELVMGILKHLPNAPSTNQSVRLEYLPESGPGSEGWQTDSRIPACSLTQALTFL
LDITTPPSQSFLRKLSQLTKKEDDQQRLLELASNFKCYSEWKAFRKPHVLEILEEFPSLE
LSAEFLLSQLPLLKPRLYSVSSSPGLYPHELHLTVSVVNYRTQDGKGPLHHGVCSTWLNT
LKEGQTVPCFIHVSGGFHLPPDPTTPTLLIGAGSGIAPFRSFWQQRFHDMKKTDLKKSPM
MLVFGCRGADTDHLYKEETFVMKENGTLKSITPAYSRQAGCPKVYVQDVLKKQLSEEVWE
VLNQRSGHVYVCGSMNMARDVAHAIQEILVSRLGITLTQAGEYLGQLKVEKRYHEDIFGA
NT seq 3243 nt   +upstreamnt  +downstreamnt
atgggaaagatcattcacgataaaatgaaggagctccccgtgacccagacaaaggttaag
gaaaacagagtcagcagatgtccgatgtcagcacaaatgatgaaaaactttcaaaatggt
tcaagccaccaggacacactttatcaccgagctgtcaagagtcagctctgcaagccgaaa
atgtgtgagggatccataatgaacccaaagactttaatgcgttcttctgccgtttcccca
ccttccaccaatgaactcctcacgcaggccatcgatttcatcaaccagtactacaaatcc
ttcaaaaccttgaaaattgatgagcatctggcccgtgttaatgaggtggccaatgagatt
gatgccactggaagttatcagctcaccccacaggagctcgcatttggagccaaacaggct
tggaggaacgcgcccaggtgcatcggcaggattcagtggtccaatttacaggtgtttgat
gcacgcaaatgcaggacggctaaggaaatgttccagttcatgtgttctcacatcaagttt
gccacaaatggaggcaatttaaggtcagccatcactgtgttccctcaaagaaccgatgac
cagcatgatttccgggtttggaacagtcaactcattagatatgctggctatcagatggag
gacggacgaattattggggacccttctaatgtggagttcactgagatttgtgtccaactt
ggatggacaccaaagtacgggtcctttgatgtgctgccactgatcttgcaggccaatggg
gaagatcctgaactatttgaaattcctccggagttggtactggaggttgaaatggagcac
ccacagcataagtggttcaaagatctgaacctcagatggtacgcactgcctgcagtgtcc
aatatgttgctggagattggtggacttgagttcacagcatgtcctttcaatggttggtac
atgggcactgagattggtgtgagggacttctgtgatactcagcgctacaacattcttgag
aaagttggacgttgtatggggttggatacacacaacttgtcatcactctggaaggatgag
gctctggttgccatcaatgttgcagtgattcacagttttcagaaaaataaggtgaccatc
acggaccaccactctgccgctgagtccttcatgaagcacatggagactgaattgcgcctg
cgtggtggctgtcctgctgactgggtctggctggtgcctcccatgtctggctctctgacc
cctgtgttccaccaggagatgatcagctacatcctgtctcccttctattactaccagcct
gatccctggtcaacatatgtctggaaagaccaaacaaaaggactaaagaaacgaaaacga
atcagcttcaacgcacttgcaaaggcgatggtcttctctcaaatactcatgcagtctgcc
ttgaaaaagagagtgccttgcaccatcctctatgctactgaaacaggaaaatctcagacc
tttgctataaagctcaagtcaatgctcagctgtgctttcaatcccaggctactttgcatg
gaggactacaattgtcaggacctcaagaaagagcgtcttatgatggtggtcaccagcaca
tttggcaatggagaccctccaggaaatggagagagttttcagaagcagctcatgaacttg
aaaaagctgcaaaacaatatgaggtacggtgtttttggccttggctctcgcatgtaccca
cagttttgtgcttttgcccatgccgtggatgataagctcgcagagttgggaggcaaacgt
gttgcaccgatgggagagggagatgagatcaatgggcaggaagaggctttctctgcctgg
gcttgcaacgtgtttaaggctgcatgtgaggaattcggtgttaagggccaactgtcaggg
tctgaacgaggtctaacagagacctgggatgctctgagacaccgagtgcaacctgacagc
agcaccctagactgcatctcagccctgtcagcactccactctaaaactgtgtttcccatg
aagctgaagaagagaaagaatctccagagcaaagagtcaagccgctctactttacttgtg
gagctggaggtggattgtgggagagaggtcttgaattatgctgcaggtgaccatgtagga
gttttcccagggaattcacatgagctagtgatgggcattctgaagcaccttcccaatgct
ccttccaccaatcagagtgtccgactggaatacctgcctgaatctggccctggaagtgaa
ggatggcagacagattctcgtatcccagcttgctctctaacccaggctcttacattcctc
ctggacatcaccacaccaccttctcaaagcttcctacgcaagctctcacaattgaccaag
aaggaagatgaccaacagcgcctgttagaactggcatcaaacttcaagtgttactcagaa
tggaaagcattccgtaagccccacgtcttggagattctggaggagtttccttccctggag
ctctctgcagaattcctcctcagtcagctacccctgctgaagccccgcctctactctgtc
agctcctcccctggtctctaccctcacgagcttcacctcacagtgtctgtggtcaactac
cgcacccaagatggaaagggtccgctacatcatggtgtctgcagtacatggctcaacacc
cttaaagaaggacagacagtgccctgctttattcatgtatccggtggattccatcttcca
ccagatcccaccacgccgactctcttaatcggagcaggaagtggcattgctcccttccgc
agcttctggcagcaacgcttccacgacatgaaaaagacagatttgaaaaagagtcctatg
atgctggtgtttggatgtcgtggtgcagacacggatcatctttataaagaggaaacattt
gttatgaaagaaaatggcacattgaagagcatcactccagcgtactctcgccaggctggt
tgccccaaggtgtatgttcaggatgtcctgaagaagcagcttagtgaagaggtttgggag
gtcttgaaccagaggtctggacatgtgtatgtgtgtgggagcatgaacatggcccgggat
gtcgcacacgctatacaggaaatcctggttagccgtctgggtataacactcacgcaggct
ggagaatatctgggccaactaaaagttgaaaagaggtaccatgaggacatctttggagca
taa

DBGET integrated database retrieval system