KEGG   Ictalurus punctatus (channel catfish): 108278865Help
Entry
108278865         CDS       T04658                                 

Gene name
ldlr
Definition
(RefSeq) low density lipoprotein receptor
  KO
K12473  low-density lipoprotein receptor
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108278865 (ldlr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ipu04131]
    108278865 (ldlr)
Membrane trafficking [BR:ipu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    108278865 (ldlr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF EGF_CA SGL hEGF TMEM154
Motif
Other DBs
NCBI-GeneID: 108278865
NCBI-ProteinID: XP_017348017
UniProt: W5U5B7
LinkDB All DBs
Position
2
AA seq 867 aa AA seqDB search
MEKTLFLFFVIYSASPVQTEVGSCGSRNFQCGNGKCITMRWICDGTDDCGDGTDELPASC
MAKTCKPSEFHCGGRLNQCVPNSWKCDGKADCENGADEAGCSPRQCLNGEFRCSNGQCVS
QAFVCDEDADDCDDGSDEADCQPTTCNPAAFRCNNSVCLPRMWVCDGDSDCTDGSDEWPQ
NCGDQSSSPRKPCSSVDFHCGTGECIPNVWRCDGDTDCPDRSDEKDCTVSTCQPDQFRCG
DGSCIHGIRQCNQVYDCHDMSDELGCVNATHCDAPSRFQCRSGECISMDKVCDKQRDCRD
WSDEPLRECDSNECLYNNGGCSHICNDLKIGYECLCPSGFQLVDKKRCEDIDECASGDAC
SQICVNQVGSYKCECSEGYQVDPTTKACKAIGTVAYLFFTNRHEVRKMTLDKSEYTQVIS
RQKSIVALDMNMANKEIFWSDLSLKKIYRAPMDAALDSSQHSTVIDSGLDAAEGIAVDWI
HGNIYWTDSVRRVVSVATEDGKKRKTLFRKDLTKPRAIVVDPINNFVYWTDWGTPAKIEK
GGLNGVDRSTLVSDNIVWPNGITLDLLNQRLYWVDSKLHTLASIDVQGGGRRTLIIDQGR
LAHPLSVTVFEERVFWTDVSNNAILSADRVTGKDITKVAEHLTSPEDIVLYHNLKQPSAV
NWCKINNGGCEFLCLAAPQVSIFSPKYTCACPDNMMLGIDMRKCVPAVPTTAPSIQPKVS
TTGHPHITPRAIPKTSAPRASKTSAPIITTVVKTQTTEASRAKTSPGNTHYEVTTQTNSH
GAVAAVRKESSTLLALYIALPLVVLCLLGFGGMLLWRNWKLKNTNTIHFENPVYQKTTED
KVHICKNYSSDGYSYPPRQVVSLEDEL
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagactttatttttgttcttcgtgatatattcagcgagcccagttcaaacagag
gttggatcctgtggctccaggaatttccagtgtggcaatgggaagtgtattacaatgaga
tggatatgtgatggtacagatgactgcggtgatggcactgatgagcttcctgcttcctgc
atggcaaagacatgcaaacccagtgagttccactgtgggggacggctaaaccagtgcgtg
ccgaacagctggaaatgtgatggcaaggcagactgtgagaacggtgctgatgaagccggc
tgcagtccaagacagtgtctgaatggtgaattccgctgcagcaatggtcagtgtgtgtct
caggctttcgtctgtgatgaagatgctgatgactgtgacgacggcagtgatgaagcggac
tgtcagcccactacctgcaacccggctgcttttcgctgcaacaactctgtgtgcctgcca
cgcatgtgggtctgtgacggagattccgattgtacagacggttcagacgagtggcctcag
aactgcggcgaccaatcttcatctcccagaaagccctgctccagtgtagacttccactgt
ggcactggggaatgtattccaaatgtctggagatgtgatggagataccgactgcccggat
cgatcagatgagaaagactgcaccgtatccacatgccagccagatcagttccgctgtggt
gatggatcatgtatccacgggatccgccagtgtaaccaggtgtatgactgtcatgatatg
agtgatgaactaggctgtgtcaatgccacccattgtgatgcaccatccaggtttcagtgt
cgcagcggtgaatgcatcagcatggacaaagtatgtgacaagcagcgtgattgtagggat
tggtctgatgagcctctgcgtgagtgtgattctaatgagtgtctgtacaacaacggtggc
tgttctcatatctgtaatgacctaaagattggctatgagtgcttgtgccccagtggattc
caattggtagacaagaaacgctgtgaagatattgatgagtgcgccagtggggatgcatgc
agtcaaatctgtgtgaatcaggtgggcagctacaagtgtgagtgttctgaaggttaccaa
gtagatccaacgaccaaagcatgcaaagctattggaactgttgcctatctattcttcact
aaccgccacgaggtgaggaagatgactctggataagagtgagtacacgcaagtcatctcc
cgtcagaaaagcatagttgccttggacatgaacatggccaacaaggagatcttctggtct
gatctgtccctcaagaaaatttatagagctcccatggatgcagcattagactcatctcaa
catagcactgtgattgactctggcttggatgcagctgaggggattgcagtggactggatc
catggtaatatttactggacagatagtgtacgtcgtgtcgtctctgtagctacagaagat
ggaaagaagcgcaagacgctcttcagaaaagacctgaccaagccaagagctattgtggtt
gacccaattaataattttgtatactggactgactggggtacgcctgctaaaattgagaag
ggtggcctgaatggagttgatcgcagcactttggtgtctgataacattgtctggcctaat
gggataacgcttgatctgttgaaccagcgtctgtactgggtggactctaaactgcatacc
ctcgccagtattgacgtgcagggaggtggccgtcgtacactcattatagaccagggcaga
ctggcacatccattaagtgtcacagtgtttgaggagcgagtattctggactgatgttagc
aacaacgctatcctgagtgctgaccgtgtgacggggaaagacatcacaaaagtggcagaa
caccttacatctccagaggacattgtgctgtatcacaatctgaaacagcccagtgctgtg
aattggtgcaagatcaacaacggtggatgcgagttcctgtgcttggccgcaccacaggtc
agcatcttctcacccaagtacacatgtgcttgtcctgacaacatgatgctgggcatagat
atgaggaaatgtgttcctgctgttccaacaacagcaccatcaatccagcccaaagtttct
accacaggccaccctcatataaccccacgcgctataccaaaaacgtctgccccaagagcc
agcaagacttcagctccaatcatcaccactgtggtgaagacacaaaccacagaagcttcc
agagccaaaacctccccaggcaacactcattatgaagtgaccacacagacaaacagtcat
ggtgctgtcgctgcagtcagaaaagaatcgtcaacattgctggcactttacattgcattg
cccttggtggtgttatgcctcctgggatttggtggcatgttgctgtggaggaactggaag
ctgaaaaacaccaacaccattcattttgaaaatccagtctaccaaaagaccaccgaggat
aaagttcatatctgcaagaactacagctctgatggctactcctaccctccgaggcaagtt
gtcagtcttgaagatgaattatga

DBGET integrated database retrieval system