KEGG   Ictalurus punctatus (channel catfish): 108278950Help
Entry
108278950         CDS       T04658                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EHMT1-like
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108278950
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ipu03036]
    108278950
Enzymes [BR:ipu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108278950
Chromosome and associated proteins [BR:ipu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108278950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3 SET Pre-SET
Motif
Other DBs
NCBI-GeneID: 108278950
NCBI-ProteinID: XP_017348234
UniProt: A0A2D0SZZ0
LinkDB All DBs
Position
18
AA seq 1301 aa AA seqDB search
MRIDFFFLFLSAAIGFLLVRGIVGPVSMPAGLVKGITGKREPMKTESMKDSHNEAEEGLE
EPSIRRLEPLKAAEELNGTFKSTEPDKAQQDLDVQRASAQSHAVENGLSETDPPHGSTVG
SNGYILSKAQDDSPATQHRTNWSPKGTSPVGYAAKTLPLSSTSQTQGQGALRTNTSTGPS
LAEGRLENETKNGTATNTPPRVTVHRARKTMSRPASNHALKVLNREIKEPSVVKGESVDR
SEAQPPVQAPPTQNQLPQKQTDATPAPIATPAKTHTASVLRKKKRKMGTYSLVPKKKTKV
LKQRTVLEMFQRAPQSPATPEQPKEIVQVNGDRAENESDESESDDDSEDEEEMTGKEMAE
ASQEDSRLASIPQLGEEHESEETAEEEGEEEQDESDLSSESSLKKKVKKKAKADSPWLRP
ARKRKKKFKTKSMEISGMNAQTQLEIPAQTTAPLTSPADQDKEYTEVPLESLNLKAQDAL
LNTESTEASSTAQSSSADMVQELPLCSCRIETPKSREILTLADRKCMATESVDGQVRTCS
ASNLSRCQSAVLKHEMMRPSNSVQLLVLCEEHRTGMIKHQCCPGCGYFCRAGTFMECQPE
VNISHRFHSHCASVLKGQSFCPHCGEEVSKAKEVTIAKADTTSTVPQSQTPSTPVTSEGK
ADTTTGGLSRLSLPGEGRADSTLSKPSEAGNGSLTPEASRPEHVGAGAVAGPPITPPKET
LETILLALDAEKPKKLRFHPKQLYISAKQGELQKVLMMLVDGIDPNFKMESQSKRTPLHV
AAEAGHQEVCHMLVQAGANLDICDEDQRTPLMEACENNQLDTVRYLLRAGAIVSNKDAEG
STCLHLAAKAGHFNIVKHLLFTGLVDINCQDDGGWTAMIWATEYKHVELVKLLLSKNADP
NIRDKEENICLHWAAFSGCVEIADVLLSAKCDLNTVNVHGDSPLHIASRENRLDCVTLFL
LRGADVNLKNREGDSPLECCSQNSKVWSALHASKRQREASGEGRASGEKLLNRDISRGYE
RVPVPCVNAVDNEPCPNDYKYVPDSCVTSPMNIDKNITHLQYCICKDDCSSASCMCGQLS
LRCWYDKESRLLPEFCSEEPPFIFECNHACSCWRTCKNRVVQNGLRIRLQLFRTQKTGWG
VRTLQDIQQGTFVCEYVGEIISDAEADVREIDSYLFSLDSKVGDMYCIDARFYGNISRFI
NHHCEPNLFPCRVFTSHQDLRFPHIAFFASKNISAGDELGFDYGDHFWDVKGKLFSCQCG
SSQCKHSAAAIAQRQADSTPGEPQATTLPDTSSSTTPSSPT
NT seq 3906 nt NT seq  +upstreamnt  +downstreamnt
atgaggattgattttttttttctttttttgtcggcagccattggcttcctgttggtgaga
ggcattgttgggcctgttagtatgcctgctggtttggtcaaagggatcacagggaagaga
gaaccaatgaagactgagagtatgaaagactcgcacaacgaagcagaagaaggccttgag
gagccctcgattaggcgactagaacctttgaaagcagcagaagagctgaatgggaccttt
aagagcacagaacccgacaaagctcagcaggacctcgatgtccaaagggcatccgcccaa
tcacatgccgtggagaatggactctcggaaaccgatcctcctcacggctccacagtgggc
agtaacggatatattctcagtaaagcccaggatgactcgccggctacccaacacaggact
aactggtcccctaagggaacttcacccgtagggtacgcagctaaaacactccctctttca
tctacatctcaaacccagggccagggagctttaaggactaacacaagcacagggcccagt
ctggcagaggggcgcttggaaaacgagactaaaaacggcactgctacgaacacgcctcca
cgtgtgacggtacaccgagcacgcaagaccatgtccaggccagcctcgaatcacgcacta
aaggttttaaacagggaaataaaagagccaagcgtggtgaaaggtgagagtgtggacaga
tcagaagctcaaccgcctgtgcaagctcctcccactcagaaccagctacctcagaagcaa
accgatgccacaccagcaccaatcgccacaccagccaagacacacacagcatctgtgttg
aggaagaagaagagaaagatgggaacatacagccttgttcccaagaagaagaccaaagtg
ctaaagcagcgcacggttctggagatgttccagcgtgcgccccagtctccggccactcct
gagcagccaaaagagattgtgcaggtgaacggggatcgagcagagaacgagtctgacgaa
tcagagtcggacgatgattccgaagatgaagaagagatgaccggaaaagaaatggccgaa
gcatctcaggaggacagcagactggcttcaatcccacagcttggagaggagcacgagtct
gaggagactgcagaagaggaaggggaagaagagcaagatgagtcagacttgagttctgaa
tccagcttgaagaagaaggtgaaaaagaaggccaaggcagacagcccttggctccggcct
gccaggaaacgtaaaaagaagtttaagacaaagtccatggaaatttcaggcatgaatgcc
cagactcaattagagattccagcccaaactactgctcctctcacttctcctgctgaccag
gacaaagagtacacagaggttccattggagtcgcttaacctgaaagcccaggatgccttg
ctaaacacagaaagcactgaagcctctagcacagcacagagttcatcggcggacatggtg
caggagcttccgctgtgtagctgccgcatcgagacacccaagagccgagagatcctcact
ctggctgacaggaagtgcatggcaaccgagagtgtggatggacaggtgagaacatgcagt
gcaagcaatctgagtcggtgtcaaagtgcagtgctgaagcacgagatgatgaggccgtcg
aactctgtgcagctgctggtgctgtgtgaggagcatcgcacaggaatgatcaaacatcag
tgctgccctggctgtggctacttctgtagggcgggaaccttcatggagtgccagccagag
gtgaacatctctcaccgctttcatagtcactgcgcgtcagtactgaaaggtcagagcttc
tgcccacactgcggtgaggaggtcagcaaggccaaagaggtcaccatcgccaaagcagac
accacctctacagtgccccagagccagacccccagcaccccggtgacttcagagggcaag
gcagacaccaccactggagggctgtctcgcctctcattaccgggagaagggagagcagac
agcactttatccaaaccttctgaagctgggaatggatcactcaccccggaagccagcagg
ccggaacacgtgggtgcaggagctgttgccggaccccctataacacctcctaaggagact
ctggaaaccattttgttggcactggatgcagagaagcccaagaagcttcgctttcaccct
aaacagctgtacatctctgctaagcagggggagctgcagaaagtcttaatgatgctcgtg
gatggaattgacccaaactttaaaatggagagccagagcaaacgtacgccgcttcatgta
gcagctgaggccggacatcaagaggtctgccacatgttggtccaggccggtgccaacctg
gacatatgtgatgaggaccagcgcacacctctgatggaggcctgtgagaacaatcagttg
gatacagtacgctacctactgagagctggagccatcgtttccaacaaggatgctgaaggc
tctacgtgtctccacctcgctgctaaggctggacattttaatatcgtaaaacacttgctg
tttacaggccttgtggacattaactgtcaggacgacggtggctggacagcaatgatttgg
gcgacagagtacaaacacgtcgaactggtcaagctgctgctatctaaaaatgccgatccc
aacatcagagacaaggaggaaaatatctgtttgcactgggcagctttctccggctgtgtg
gagatcgctgacgttcttctgagtgccaagtgcgatcttaacacggtcaacgtgcacgga
gactcgcccttgcacatcgcatcgcgggaaaaccggttggattgtgtcacgttgtttctg
ttgcggggggctgatgtgaacctaaaaaacagggaaggagactcgccactagagtgctgc
agccagaactccaaggtgtggagcgctctgcacgccagcaagaggcagagggaggcgagc
ggtgaaggacgcgcctcaggagagaagctcctcaacagggatatatctcgaggttacgag
agagtacctgtgccatgtgtgaacgctgtggacaatgagccttgccccaatgactacaaa
tatgtgcctgacagctgtgtcacctcccccatgaacatagacaaaaacatcactcactta
cagtactgcatctgtaaagacgactgctcctcggccagctgcatgtgcggtcagctcagc
ctgcgctgctggtatgacaaggagagccgtctgctgccagagttctgctctgaggaaccg
cctttcattttcgagtgcaaccatgcctgttcctgctggagaacctgcaagaaccgcgtt
gttcaaaatggactacggattcgactgcagctgttcaggactcaaaaaacgggctggggt
gttcggacattacaggacatccagcaaggaaccttcgtctgcgagtacgtcggggaaatc
atctcagacgcagaagcagatgtccgggagattgattcctaccttttcagcctggacagc
aaggttggcgatatgtattgtatagacgcccgtttctatggcaacatcagccggttcata
aaccaccactgcgagccgaacctgttcccctgccgagtgttcacctcccaccaggacctg
cgcttcccgcacatcgcgttcttcgccagcaagaacatcagcgccggagacgagctaggg
tttgattatggtgatcatttttgggacgtgaagggcaaactgttcagctgccagtgcggc
tcgtctcagtgtaagcactcggcggcagcgatcgctcagcggcaggcggacagcacgcca
ggagaaccgcaggccaccaccctcccagacaccagctcatctaccacaccatccagcccc
acctga

DBGET integrated database retrieval system