KEGG   Ictalurus punctatus (channel catfish): 108279829
Entry
108279829         CDS       T04658                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
ipu04020  Calcium signaling pathway
ipu04260  Cardiac muscle contraction
ipu04261  Adrenergic signaling in cardiomyocytes
ipu04270  Vascular smooth muscle contraction
ipu04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108279829
   04020 Calcium signaling pathway
    108279829
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108279829
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108279829
   04261 Adrenergic signaling in cardiomyocytes
    108279829
   04270 Vascular smooth muscle contraction
    108279829
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ipu04040]
    108279829
Ion channels [BR:ipu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108279829
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ PKD_channel CAC1F_C
Other DBs
NCBI-GeneID: 108279829
NCBI-ProteinID: XP_017349830
UniProt: A0A2D0T5E6
LinkDB
Position
19
AA seq 2104 aa
MDVREKARIYVCATSRSDIIHKHRKPSTSACHGLCDYVFNAAWTHSCITICTVEFFISTW
TTDWCPFKKRIFSEEHTKGSNYTSPSLVMVSNVSEKEHSVSVSKGSMVGLAPEHIPTPNA
ALSWQAAIDAARQAKLIRSAAAAPISTAISTQQQRQHYSKPKKQTSTVATRPPHSLLCLT
LKNPLRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLEQVEYLFLI
IFTVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKENGGTPIGGKA
ADFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLE
LFMGKMHRACFSFRNGHRGPLAEEKPAPCAPNNAHGRHCTPPNITQCMMGWEGPNDGITN
FDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLS
GEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENDEGLDDAKPRNLSI
PASESESVNTDIPPTGDLEGEPCCTHLVNRISKSKFSRYSRRWNRLCRRKCRAAVKSNVF
YWLVIFFVFLNTLTIASEHHKQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVS
LFNRFDGFVVCGGILETILVETKVMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLN
SVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDW
NSVMFDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKE
EEEEKERRKLARMASPEKWQGNEKLPVEKKEEKIEMKSITSNEETPKTTKINIDDNDENL
YPVNDFPGEDEEEEPDMPVGPRPRPLSDIHLKEKAVPMPEARAFFIFSHTNKYRVLCHRI
VNHNIFTNLILFFILLSSISLAAEDPVKSDSFRNQILGYADHVFTGLFTIEIILKMTAYG
AFLHRGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLK
HVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYFCTDSSKPTQTECRGDYILY
KDGNVGKPEKVARNWANSEFNFDDVLQGMMALFAVSTFEGWPSLLYRAIDSHAEDTGPIY
NYRVVISVFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKA
RPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQSPSFNKAMNILNM
LFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINPADPSSSSHSSV
GRQMGLQNTEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIV
MLFFIYAVIGMQMFGKIALTDNSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPN
RPCEKGSEEAPTSEECGSHFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGP
HHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLN
SDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDD
EVTVGKFYATFLIQEYFRKFKKRKEQGLVAKVPPKTALSLQAGLRTLHEMGPEIRRAISG
DLTAEEELEKAMKETVCTASEDDLFRVKRSDGFFRNHMNYYQSDDCTDFPPSFTSQRPLH
ISKSGSPGEGKSPSCEKLVDSTFTPSSYSSSGSNANINNANNTSISHCYPSISTVDGHIR
PLLIPVLLPCSSWSFPNKSSDSGECHFPVISRGEADKDEMHDMMVTETECQHEQDMLSTK
MLVLQNDECKQLAVMEETDGGGDRRPWQFAQQTVLCPTALSRRSSFHLECVSRQSRTETS
HKTTLPLHFVQHQVLILEQLDRYSQDPSFVKVAKQELAATHDMTMEVMDSVSESILNANG
PHSPNSNLLPYMHCSNGVRTNQGQKRAWEIKVHEKGVGGLHVAEHSQLNSKLIVDEDMVC
VTSL
NT seq 6315 nt   +upstreamnt  +downstreamnt
atggacgtccgagaaaaggccaggatatacgtgtgtgcgacatcaaggtcagacatcata
cacaaacacagaaagccaagtacttctgcgtgccacgggttgtgtgattacgtgttcaat
gctgcctggacacactcatgcattactatttgcactgtggaatttttcatatcaacatgg
acaacggattggtgtccttttaagaaacgtatcttctccgaagagcatactaaaggttct
aactacaccagcccatctctggttatggtgtctaatgtaagtgagaaggagcacagtgtt
agtgttagcaaaggtagtatggtaggtctggcaccagaacacatccctacacctaatgcc
gccctcagctggcaggcagctatcgatgcagcacgtcaggccaagctgataaggagtgca
gcagcagcacccatctccacagcaatttctacgcagcaacagcgtcagcactacagcaaa
cccaagaaacagacgagcacagtggccacacggcccccgcactccctcctctgccttacc
ctcaaaaaccccctcagacgagcttgtatcagtattgtggagtggaaaccctttgaaatc
atcattttaatgactatttttgctaactgtgttgccttagctgtctacatcccctttcct
gaggatgactccaatgccaccaactccaatctggagcaagtggaatatctcttccttatc
atctttacagtggaagcatttctgaaggtcatcgcatatgggctgctatgtcaccccaat
gcctatttaaggaatggctggaatctgttggatttcatcattgtcgttgtagggttgttc
agtgctatattagaacaggccacaaaagaaaatggagggacacctattggagggaaggca
gcagactttgatgtgaaggccctgcgtgcttttagagtactgagacccctacgattggtg
tccggtgttcccagtttacaagtagtgttgaactctataattaaggccatggttcctctg
ctacacatcgctctgcttgtactctttgtgatcatcatctacgccatcatcggcctagag
ctcttcatggggaagatgcaccgtgcatgcttttccttcagaaatggacacagagggccc
ctagctgaggagaagcctgcaccttgtgccccaaataatgcccatgggcggcactgcacc
ccacccaacatcacccagtgcatgatgggatgggagggaccaaatgatggcattacaaac
tttgataactttgcatttgccatgctaacagtgtttcagtgcatcaccatggagggctgg
actgacgtcctctattggatgcaggatgctatgggctatgagcttccctgggtctatttt
gtcagtctcgtcatctttggatcctttttcgttctaaatctggttcttggggtgttgagt
ggagagttctctaaggagcgtgaaaaggcaaaggcacgtggagatttccagaagttacga
gaaaagcaacagctagaagaggatctaaagggctacctggattggatcactcaggctgag
gacattgacccagagaatgatgagggactggatgatgccaaaccgagaaacttgagtatt
ccagcaagtgagagtgagtccgtgaacactgacatccctcccactggagatttagaggga
gaaccctgctgtacccatctagtaaataggatctccaaatccaaattcagtcgatattct
cgtcgctggaatcgtctgtgcaggcgtaaatgtcgagctgctgtgaagtcgaatgtcttt
tattggctggtgattttttttgtattcctgaatactctaaccattgcctcggaacaccat
aaacaaccacagtggctgacggatgtacaagatatcgccaacaaggttctcctagcgctc
ttcactggagaaatgcttttgaagatgtacagtttgggactgcaggcgtattttgtctca
ctttttaatcgctttgatggttttgtggtgtgtggtgggatactggagaccatcctggtt
gagacgaaggttatgtcccctctaggcatatcagtgctgcgttgtgtgcgcctgctgcgc
atcttcaaaatcaccaggtactggaactctctcagcaacctggtagcatctttgctgaac
tctgtccgttccatcgcctccctgctgctgctgctcttccttttcatcattatttttagt
ttgctaggcatgcaactgtttggtgggaagttcaacttcgatgagacacgtcggagcaca
tttgacaactttccccagtcattactcacagtcttccagattttgactggagaggactgg
aactcagtaatgtttgatgggattatggcctatggtggaccatcatttcctggtatgctt
gtgtgcatctacttcatcattctcttcatatgtggaaactacatcctcctgaatgtattc
ttggccattgctgtagacaaccttgcagatgcagagagtttgacatcagctcaaaaagag
gaagaagaagagaaggaaaggcggaagctggccagaatggctagtccggagaagtggcaa
ggcaatgagaaacttccagttgagaaaaaagaagaaaagattgaaatgaaatcaattacc
tcaaatgaagaaactccaaaaaccaccaagatcaatattgatgacaacgatgagaatcta
tatccagtgaacgacttcccaggagaggatgaggaggaggagccagacatgccagtgggc
ccaaggccaaggcctctttcagacattcatctgaaggagaaggctgttcctatgcctgaa
gctagagctttcttcatcttcagtcatacaaacaagtatagagttttgtgccataggatt
gtcaaccacaacatcttcaccaatcttatactcttctttattctgctaagtagtatttct
ctggctgcagaggacccagtaaaaagtgactcattcaggaatcagattctaggttatgca
gatcatgttttcacgggtctcttcaccatagagattatattaaagatgacagcatacgga
gcattcctccataggggttctttctgtcgtaactacttcaacatcctggatctggtggtg
gtcagtgtctctctcatctcttctgggattcagtcaagtgccattaacgttgtgaagatt
ttgagagttcttagagtcctcagacccctgagagccattaacagggccaagggcctcaaa
catgtagtccagtgtgtatttgtagcgatccgcaccattgggaacattgttattgtcacc
actctgctgcagtttatgtttgcctgcattggagtacaactctttaagggcaagctctac
ttttgcacagactcttctaagccgacccagacagaatgcaggggggattacattctgtat
aaagatggtaatgttgggaagccggaaaaagttgctcgtaattgggccaacagtgaattc
aactttgatgatgtgcttcaaggcatgatggccttgtttgctgtgtccacttttgaagga
tggcctagcctcctgtacagagccatagactcccatgcagaagatactggccccatctac
aactaccgtgtggtcatctctgtcttctttatcatctatatcatcatcatcgccttcttc
atgatgaacatctttgtcggttttgtcattgttacattccaggagcaaggagagcaggag
tacaagaactgcgagctggacaagaaccagcggcagtgtgtggagtatgctctaaaggca
cggcctctgcgcaggtacattccaaagaatccataccagtataaggtgtggtatgtggtc
aactccacctactttgaatatctgatgttcactctaatcctacttaacaccatctgcttg
gcaatgcagcaccatggccagtcaccatccttcaacaaagccatgaacatcctgaacatg
ctcttcactggtctgttcactgtggagatgatcctcaaacttattgccttcaaacccagg
ggctattttagtgatccttggaatgtttttgacttcctcatcgtaattggcagcattata
gatgtcattctgagtgaaataaatccagctgacccttcttcctcttctcattcctctgtg
ggaagacaaatgggtctccagaatacagaagataatgccaggatttccattaccttcttc
cgactctttcgagttatgagactggtaaagctgctttcacgtggagagggaattcgaaca
ttgctgtggacctttattaaatctttccaagcacttccttatgtagcattgctcatagta
atgcttttcttcatctacgctgttattggaatgcagatgtttggtaagatcgcactgaca
gacaacagccagatcaaccgaaacaacaattttcaaacattcccgcaagctgtgctgctg
cttttcagatgtgcaacaggtgaggcctggcaggagataatgctggcctgctccccaaac
cgcccatgtgaaaagggttctgaagaggcccctaccagtgaggagtgtggcagtcatttt
gccatcatttactttgtcagtttctacatgctttgtgcttttctgattatcaacctgttt
gtggcagttataatggacaactttgactacctgacacgggactggtccatactaggacca
catcatcttgatgagttcaagaggatatgggcagagtatgaccctgaggcaaagggaagg
attaagcatctggatgtggtgacattgcttagaaggattcagccacccctggggtttggc
aaactctgtccccacagagtggcctgcaagcgcctggtatccatgaacatgcctctgaac
agtgatggcacagtaatgtttaatgctactctgtttgccctggtgcgcacagcccttcgc
attaaaactgaaggtaatctggagcaggcaaatgaagaactgagggcaatagtaaaaaag
atctggaagaggaccagtatgaagttgctggaccaggttgtgcccccagcaggagatgat
gaggtgacagttgggaagttctatgccacattcctcatccaagaatacttcaggaagttc
aaaaagaggaaagaacaaggcttagtggctaaagtgcctccaaaaacagctctctctctg
caggctggcctgcgtacactgcatgaaatgggtccagaaatacggagggcaatatcagga
gacctcactgcagaggaagagctggagaaggccatgaaggaaacagtgtgcactgcatct
gaagatgatctcttcagggtgaagcgatcagatggtttctttagaaaccacatgaactat
tatcagagtgatgactgcactgatttccccccatccttcaccagtcagcggccactgcac
atcagcaagtcaggcagccctggagagggcaagtcaccgtcttgtgagaaactggtggac
tccaccttcacaccaagcagctattcctcctcaggttccaatgccaacatcaacaatgcc
aacaacacatccatcagccactgttacccatccattagcactgtggatgggcacatcagg
cccctgctcatacctgtgctactcccatgctcttcatggtccttccccaataaaagctca
gactcgggtgaatgtcatttccctgtaatctctcggggagaggcggataaagatgaaatg
catgacatgatggttacagagactgaatgccaacatgagcaggacatgctctccactaaa
atgttggttttgcaaaatgatgagtgtaagcagttagctgtgatggaagagacagatggg
ggtggggacagaagaccatggcagtttgcccaacagactgttctctgtccaactgcacta
agtcgacgatcttcctttcatctagagtgtgtgagcagacagagcagaactgaaacttcg
cataagacaacgttgcccctgcactttgtccagcatcaggtgttgatcttggaacagttg
gaccgctactcacaggacccctcattcgtcaaggtggccaagcaggagctggctgctaca
catgacatgaccatggaagtgatggatagtgtgtcagaaagcattctcaatgccaatggg
cctcacagcccaaatagcaacctcctgccttatatgcactgcagcaatggagtgagaacc
aaccagggacaaaaaagagcctgggaaataaaggttcatgagaagggggtgggaggactg
catgttgctgagcacagtcaactgaacagtaagctaatagttgatgaggacatggtgtgt
gtgacaagcctgtag

DBGET integrated database retrieval system