KEGG   Ictalurus punctatus (channel catfish): 108279928Help
Entry
108279928         CDS       T04658                                 

Gene name
braf
Definition
(RefSeq) B-Raf proto-oncogene, serine/threonine kinase
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
ipu04012  ErbB signaling pathway
ipu04068  FoxO signaling pathway
ipu04150  mTOR signaling pathway
ipu04270  Vascular smooth muscle contraction
ipu04510  Focal adhesion
ipu04810  Regulation of actin cytoskeleton
ipu04910  Insulin signaling pathway
ipu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108279928 (braf)
   04012 ErbB signaling pathway
    108279928 (braf)
   04068 FoxO signaling pathway
    108279928 (braf)
   04150 mTOR signaling pathway
    108279928 (braf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108279928 (braf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108279928 (braf)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108279928 (braf)
   04914 Progesterone-mediated oocyte maturation
    108279928 (braf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108279928 (braf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ipu01001]
    108279928 (braf)
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108279928 (braf)
Protein kinases [BR:ipu01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   108279928 (braf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 APH Kdo
Motif
Other DBs
NCBI-GeneID: 108279928
NCBI-ProteinID: XP_017350072
UniProt: A0A2D0T588
LinkDB All DBs
Position
19
AA seq 782 aa AA seqDB search
MAALSSAESPPAVFNGEPMAHDAEREPGPGLEALSAGFSSVCTACSASAEAEHRHDIPEE
LWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLEAIGNG
TEFCSSPTQAPLEFRLGASQSASANPNTLAVLQTPTDATRANPRSPQKPIVRVFLPNKQR
TVVPARCGMTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEV
LENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQL
DLLLTSKFLVHHPITQEEVSSEGTTPVSEVCPSIPPSDSTGSLCHPTVSPSKSIPIPQSF
RPGEEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGLQRSDGGSTTGLSATPPAS
LPGSLTNVKVPQKSPCQQRERKSSSSSEDRNKMKTLGRRDSSDDWEIPEGQITLGQRIGS
GSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYTTKPQL
AIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLH
EDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRLQDKNPYSFQSDVYAFGIV
LYELMSGVLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMADCLKKKREERP
LFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFSA
FK
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgttgagcagcgccgagtccccaccggccgtctttaacggagagccgatggcg
cacgacgccgagcgggaaccggggccgggattggaggcgctgagcgcggggttcagctcg
gtgtgcacggcgtgttccgcgtccgctgaggccgagcatcgccacgacattcccgaggag
ttatggaatatcaaacagatgattaagctgactcaagagcacatagaggcacttctggac
aagtttggtggtgaacacaaccctccatccatatacctggaggcttatgaagagtatacc
agtaaactcgacgctttacagcagagggagcagcagctgctggaggccattgggaatgga
acagaattctgctcctcccctactcaagcaccgctggagttcaggttgggggcgagccag
agcgcctctgcaaaccccaacaccttggcagtgttgcagaccccaactgacgccacccgt
gctaacccacgttcaccccagaaacccatcgtcagagtctttctgcccaataaacagagg
acagtggttccagcacgttgtgggatgaccgtaagggactcgttaaagaaggctctgatg
atgcggggtctgatcccagaatgctgtgctgtctacaggattcaggatggagagaagaaa
cccattggctgggatacagacatttcttggttaactggggaggagcttcacgttgaggtt
ttggagaacgttcccctgacaacccataattttgtgaggaagaccttcttcacgttggcc
ttctgtgatttctgccggaagctgcttttccagggcttccgctgtcagacgtgtggctac
aaattccaccagcgctgcagcactgaggtgccgctcatgtgtgtcaactatgaccaactg
gatttattattgacgtccaaatttctggtgcatcacccaatcacccaggaggaggtgtcg
tcagagggcaccacccctgtgtcagaggtgtgtccgtctatcccaccatctgactccaca
gggtcgctgtgccatccaaccgtgtccccgtccaaatccatccccatcccacaaagtttc
cggccaggggaggaagaccaccgtaatcagtttggccagagagaccgctcttcctcagcc
ccaaacgtccatatcaacacaatcgagccagtcaacattgatgacttgattcgtgatcaa
ggtttacagaggtctgatggaggctctaccactggactctcggccacgccccccgcctcc
ctacctggttccctgaccaacgttaaggtgccacagaagtcaccgtgccaacagcgggag
cgcaagtcgtcgtcctcgtctgaggaccgcaataaaatgaaaacattgggccgacgggac
tccagtgatgactgggagattccagaaggtcagatcactctgggccagcggataggttct
ggctcttttggaactgtctacaagggaaagtggcatggtgatgtggcagtcaagatgtta
aatgtcactgctcccactcctcaacaactacaggcctttaaaaatgaagtaggggtcctc
aggaaaactcggcatgtcaatatcctgctcttcatgggttacaccaccaagccacagctg
gccatcgtgacacagtggtgtgaaggctcaagcctctaccaccacttgcacattatcgag
accaagtttgagatgatcaaactaatcgacatcgcccgccagacggcccagggcatggac
tatctacatgccaagtccatcattcacagagacctgaagagcaacaatatcttcttgcat
gaggatctgacagttaagattggtgatttcggtctggctacagtgaagtcacgctggagt
ggatcacaccagtttgagcagctgtcaggttcaatcctgtggatggctcctgaggtgatc
cgactgcaggataagaacccatacagcttccagtcagatgtctacgctttcggtatcgtc
ctgtacgagctcatgtctggggtgttgccttactccaacatcaacaacagagaccagatc
atcttcatggtgggccgaggttacctctcccctgacctgagcaaagtgcgcagcaactgc
cccaaagctatgaagagactcatggctgactgcttgaagaagaaaagagaggaacggcct
ctgttccctcagatcctagcctctattgagctgttggcacgctcactacccaaaatccac
cgcagcgcctcagaaccgtccctcaaccgtgctggcttccagacagaagacttcagtcta
tacgcctgcgcctcgccaaaaacacctattcaggctggaggctacggggagttttcagct
tttaagtag

DBGET integrated database retrieval system