KEGG   Ictalurus punctatus (channel catfish): 108280031
Entry
108280031         CDS       T04658                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04012  ErbB signaling pathway
ipu04068  FoxO signaling pathway
ipu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108280031
   04068 FoxO signaling pathway
    108280031
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108280031
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 108280031
NCBI-ProteinID: XP_017350259
UniProt: A0A2D0T5U4
LinkDB
Position
19
AA seq 157 aa
MSDVRLSNGSPPLERVDARPEGHTKPSVCRNLFGSPHPGEVRQAYLDELRESEAAYREKY
NYDFVKDMPLEPGRYVWEPVDARDAPEVYSRPPRATKRVDLNASQTDCQKTQSAGKKRPS
LEDADSARQSKRVNHGEEDSSSQDSAEQTPRKSDPST
NT seq 474 nt   +upstreamnt  +downstreamnt
atgtcggacgtgcgtctttctaatggaagtccgccgctggagcgcgtggacgcgagaccg
gagggacacaccaagccttcggtgtgcaggaacctgttcggctcgccgcacccgggggaa
gtaagacaagcgtatctggacgagttgcgggagtcggaggctgcgtacagggagaagtac
aactacgactttgtgaaggacatgccgcttgagccgggcagatacgtgtgggagccggtg
gacgccagagacgcgcccgaggtttacagcaggccgccgcgtgcgaccaaacgggtggat
cttaacgcgagtcagacggactgccaaaaaacgcaaagcgctgggaagaaaagaccttcc
ctggaggacgcggattctgcacggcagagtaaaagagtgaaccacggagaggaagacagc
agcagtcaagacagtgcagagcagacacccagaaaatcagatcccagcacgtaa

DBGET integrated database retrieval system